KEGG   Macaca fascicularis (crab-eating macaque): 102139585Help
Entry
102139585         CDS       T02918                                 

Definition
(RefSeq) pseudouridine-5'-phosphatase
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcf01009]
    102139585
Enzymes [BR:mcf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     102139585
Protein phosphatases and associated proteins [BR:mcf01009]
 HAD phosphatases
  Other HAD phosphatases
   102139585
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like Hydrolase_6 HAD
Motif
Other DBs
NCBI-GeneID: 102139585
NCBI-ProteinID: XP_005586883
Position
18
AA seq 214 aa AA seqDB search
MDGLLLDTERLYSVVFQEICDRYDKKYSWDVKSLVMGKKALEAAQIIIDVLQLPMSKEEL
VEESQTKLKEMFPTAALMPGAEKLIVHLRKHGIPFALATSSGSVSFEMKTSRHKEFFSLF
SHIVLGDDPEVQHGKPDPDIFLACAKRFSPPPAMEKCLVFEDAPNGVEAALAAGMQVVMV
PDGNLSRDLTTKATLVLNSLQDFQPELFGLPPYE
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atggacggacttcttctggatactgaacgactgtattcagtggtgtttcaagaaatatgt
gatcgctatgacaagaaatacagctgggatgtaaagtccctggttatgggtaagaaggca
ttagaggcggcacagattataatagacgtcttgcagctcccgatgtccaaagaggagctg
gtggaagaaagccaaacgaagttaaaggaaatgttccccacggctgcgctcatgccaggg
gctgagaaactcatcgtccacctgcggaaacacggcatcccctttgcgctggccaccagc
tcagggtccgtgtcgttcgagatgaagacgagccgccacaaggaattcttcagcttgttt
tcccacattgtgctgggagatgaccctgaagtgcagcatggcaagccagaccccgacatc
ttcctagcttgtgccaagagattctctccccctcctgctatggagaagtgccttgtcttt
gaagatgctcccaatggggtggaggcggccctggcagctgggatgcaggtggtcatggtt
cctgacggaaacttgagccgagacctgacgacaaaggccaccctggtgctgaattccctg
caggacttccagcccgagctgtttggtttgcccccatatgagtga

DBGET integrated database retrieval system