KEGG   Macaca fascicularis (crab-eating macaque): 102143464Help
Entry
102143464         CDS       T02918                                 

Gene name
PIK3CD
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf00562  Inositol phosphate metabolism
mcf01521  EGFR tyrosine kinase inhibitor resistance
mcf01522  Endocrine resistance
mcf01524  Platinum drug resistance
mcf04012  ErbB signaling pathway
mcf04014  Ras signaling pathway
mcf04015  Rap1 signaling pathway
mcf04024  cAMP signaling pathway
mcf04062  Chemokine signaling pathway
mcf04066  HIF-1 signaling pathway
mcf04068  FoxO signaling pathway
mcf04070  Phosphatidylinositol signaling system
mcf04071  Sphingolipid signaling pathway
mcf04072  Phospholipase D signaling pathway
mcf04140  Autophagy - animal
mcf04150  mTOR signaling pathway
mcf04151  PI3K-Akt signaling pathway
mcf04152  AMPK signaling pathway
mcf04210  Apoptosis
mcf04211  Longevity regulating pathway
mcf04213  Longevity regulating pathway - multiple species
mcf04218  Cellular senescence
mcf04360  Axon guidance
mcf04370  VEGF signaling pathway
mcf04380  Osteoclast differentiation
mcf04510  Focal adhesion
mcf04550  Signaling pathways regulating pluripotency of stem cells
mcf04611  Platelet activation
mcf04620  Toll-like receptor signaling pathway
mcf04625  C-type lectin receptor signaling pathway
mcf04630  Jak-STAT signaling pathway
mcf04650  Natural killer cell mediated cytotoxicity
mcf04660  T cell receptor signaling pathway
mcf04662  B cell receptor signaling pathway
mcf04664  Fc epsilon RI signaling pathway
mcf04666  Fc gamma R-mediated phagocytosis
mcf04668  TNF signaling pathway
mcf04670  Leukocyte transendothelial migration
mcf04722  Neurotrophin signaling pathway
mcf04725  Cholinergic synapse
mcf04750  Inflammatory mediator regulation of TRP channels
mcf04810  Regulation of actin cytoskeleton
mcf04910  Insulin signaling pathway
mcf04914  Progesterone-mediated oocyte maturation
mcf04915  Estrogen signaling pathway
mcf04917  Prolactin signaling pathway
mcf04919  Thyroid hormone signaling pathway
mcf04923  Regulation of lipolysis in adipocytes
mcf04926  Relaxin signaling pathway
mcf04930  Type II diabetes mellitus
mcf04931  Insulin resistance
mcf04932  Non-alcoholic fatty liver disease (NAFLD)
mcf04933  AGE-RAGE signaling pathway in diabetic complications
mcf04960  Aldosterone-regulated sodium reabsorption
mcf04973  Carbohydrate digestion and absorption
mcf05100  Bacterial invasion of epithelial cells
mcf05142  Chagas disease (American trypanosomiasis)
mcf05146  Amoebiasis
mcf05160  Hepatitis C
mcf05161  Hepatitis B
mcf05162  Measles
mcf05164  Influenza A
mcf05165  Human papillomavirus infection
mcf05166  HTLV-I infection
mcf05167  Kaposi's sarcoma-associated herpesvirus infection
mcf05169  Epstein-Barr virus infection
mcf05200  Pathways in cancer
mcf05203  Viral carcinogenesis
mcf05205  Proteoglycans in cancer
mcf05210  Colorectal cancer
mcf05211  Renal cell carcinoma
mcf05212  Pancreatic cancer
mcf05213  Endometrial cancer
mcf05214  Glioma
mcf05215  Prostate cancer
mcf05218  Melanoma
mcf05220  Chronic myeloid leukemia
mcf05221  Acute myeloid leukemia
mcf05222  Small cell lung cancer
mcf05223  Non-small cell lung cancer
mcf05224  Breast cancer
mcf05225  Hepatocellular carcinoma
mcf05226  Gastric cancer
mcf05230  Central carbon metabolism in cancer
mcf05231  Choline metabolism in cancer
mcf05418  Fluid shear stress and atherosclerosis
Module
mcf_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:mcf00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102143464 (PIK3CD)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    102143464 (PIK3CD)
   04015 Rap1 signaling pathway
    102143464 (PIK3CD)
   04012 ErbB signaling pathway
    102143464 (PIK3CD)
   04370 VEGF signaling pathway
    102143464 (PIK3CD)
   04630 Jak-STAT signaling pathway
    102143464 (PIK3CD)
   04668 TNF signaling pathway
    102143464 (PIK3CD)
   04066 HIF-1 signaling pathway
    102143464 (PIK3CD)
   04068 FoxO signaling pathway
    102143464 (PIK3CD)
   04070 Phosphatidylinositol signaling system
    102143464 (PIK3CD)
   04072 Phospholipase D signaling pathway
    102143464 (PIK3CD)
   04071 Sphingolipid signaling pathway
    102143464 (PIK3CD)
   04024 cAMP signaling pathway
    102143464 (PIK3CD)
   04151 PI3K-Akt signaling pathway
    102143464 (PIK3CD)
   04152 AMPK signaling pathway
    102143464 (PIK3CD)
   04150 mTOR signaling pathway
    102143464 (PIK3CD)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    102143464 (PIK3CD)
  Cell growth and death
   04210 Apoptosis
    102143464 (PIK3CD)
   04218 Cellular senescence
    102143464 (PIK3CD)
  Cellular community - eukaryotes
   04510 Focal adhesion
    102143464 (PIK3CD)
   04550 Signaling pathways regulating pluripotency of stem cells
    102143464 (PIK3CD)
  Cell motility
   04810 Regulation of actin cytoskeleton
    102143464 (PIK3CD)
 Organismal Systems
  Immune system
   04611 Platelet activation
    102143464 (PIK3CD)
   04620 Toll-like receptor signaling pathway
    102143464 (PIK3CD)
   04625 C-type lectin receptor signaling pathway
    102143464 (PIK3CD)
   04650 Natural killer cell mediated cytotoxicity
    102143464 (PIK3CD)
   04660 T cell receptor signaling pathway
    102143464 (PIK3CD)
   04662 B cell receptor signaling pathway
    102143464 (PIK3CD)
   04664 Fc epsilon RI signaling pathway
    102143464 (PIK3CD)
   04666 Fc gamma R-mediated phagocytosis
    102143464 (PIK3CD)
   04670 Leukocyte transendothelial migration
    102143464 (PIK3CD)
   04062 Chemokine signaling pathway
    102143464 (PIK3CD)
  Endocrine system
   04910 Insulin signaling pathway
    102143464 (PIK3CD)
   04923 Regulation of lipolysis in adipocyte
    102143464 (PIK3CD)
   04915 Estrogen signaling pathway
    102143464 (PIK3CD)
   04914 Progesterone-mediated oocyte maturation
    102143464 (PIK3CD)
   04917 Prolactin signaling pathway
    102143464 (PIK3CD)
   04926 Relaxin signaling pathway
    102143464 (PIK3CD)
   04919 Thyroid hormone signaling pathway
    102143464 (PIK3CD)
  Digestive system
   04973 Carbohydrate digestion and absorption
    102143464 (PIK3CD)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102143464 (PIK3CD)
  Nervous system
   04725 Cholinergic synapse
    102143464 (PIK3CD)
   04722 Neurotrophin signaling pathway
    102143464 (PIK3CD)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102143464 (PIK3CD)
  Development
   04360 Axon guidance
    102143464 (PIK3CD)
   04380 Osteoclast differentiation
    102143464 (PIK3CD)
  Aging
   04211 Longevity regulating pathway - mammal
    102143464 (PIK3CD)
   04213 Longevity regulating pathway - multiple species
    102143464 (PIK3CD)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    102143464 (PIK3CD)
   05230 Central carbon metabolism in cancer
    102143464 (PIK3CD)
   05231 Choline metabolism in cancer
    102143464 (PIK3CD)
   05205 Proteoglycans in cancer
    102143464 (PIK3CD)
   05203 Viral carcinogenesis
    102143464 (PIK3CD)
   05210 Colorectal cancer
    102143464 (PIK3CD)
   05212 Pancreatic cancer
    102143464 (PIK3CD)
   05225 Hepatocellular carcinoma
    102143464 (PIK3CD)
   05226 Gastric cancer
    102143464 (PIK3CD)
   05214 Glioma
    102143464 (PIK3CD)
   05221 Acute myeloid leukemia
    102143464 (PIK3CD)
   05220 Chronic myeloid leukemia
    102143464 (PIK3CD)
   05218 Melanoma
    102143464 (PIK3CD)
   05211 Renal cell carcinoma
    102143464 (PIK3CD)
   05215 Prostate cancer
    102143464 (PIK3CD)
   05213 Endometrial cancer
    102143464 (PIK3CD)
   05224 Breast cancer
    102143464 (PIK3CD)
   05222 Small cell lung cancer
    102143464 (PIK3CD)
   05223 Non-small cell lung cancer
    102143464 (PIK3CD)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    102143464 (PIK3CD)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    102143464 (PIK3CD)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    102143464 (PIK3CD)
   04931 Insulin resistance
    102143464 (PIK3CD)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102143464 (PIK3CD)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    102143464 (PIK3CD)
   05166 HTLV-I infection
    102143464 (PIK3CD)
   05162 Measles
    102143464 (PIK3CD)
   05164 Influenza A
    102143464 (PIK3CD)
   05161 Hepatitis B
    102143464 (PIK3CD)
   05160 Hepatitis C
    102143464 (PIK3CD)
   05163 Human cytomegalovirus infection
    102143464 (PIK3CD)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    102143464 (PIK3CD)
   05169 Epstein-Barr virus infection
    102143464 (PIK3CD)
   05165 Human papillomavirus infection
    102143464 (PIK3CD)
   05146 Amoebiasis
    102143464 (PIK3CD)
   05142 Chagas disease (American trypanosomiasis)
    102143464 (PIK3CD)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    102143464 (PIK3CD)
   01524 Platinum drug resistance
    102143464 (PIK3CD)
   01522 Endocrine resistance
    102143464 (PIK3CD)
Enzymes [BR:mcf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     102143464 (PIK3CD)
Membrane trafficking [BR:mcf04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102143464 (PIK3CD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_rbd PI3K_p85B PI3K_C2 DUF4135
Motif
Other DBs
NCBI-GeneID: 102143464
NCBI-ProteinID: XP_005544902
UniProt: A0A2K5TKS9
Position
1
AA seq 1044 aa AA seqDB search
MPPGVDCPMEFWTKEENQSVVVDFLLPTGVYLNFPVSRNANLSTIKQLLWHRAQYEPLFH
MLSGPEAYVFTCINQTAEQQELEDEQRRLCDVQPFLPVLRLVAREGDRVKKLINSQISLL
IGKGLHEFDSLCDPEVNDFRAKMCQFCEEAAARRQQLGWEAWLQYSFPLQLEPSARTWGP
GTLRLPNRALLVNVKFEGSEESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYT
LQVNGRHEYLYGSYPLCQFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNPAPQVQKPR
AKPPPIPAKKPFSVSLWSLEQPFCIELIQGSKVNADERMKLVVQAGLFHGNEMLCKTVSS
SEVSVCSEPVWKQRLEFDIHICDLPRMARLCFALYAVIEKAKKARSTKKKSKKADCPIAW
ANLMLFDYKDQLKTGERCLYMWPSVPDEKGELLNPTGTVRSNPNTDSAAALLICLPEVAP
HPVYYPALEKILELGRHSECVHVTEEEQLQLREILERRGSGELYEHEKDLVWKLRHEVQE
HFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSALELLDFSFPDCHVGSFAIKSL
RKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLDRALANRKIGHFLFWHLRSEMHVPSV
ALRFGLILEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKLSSQKTPKPQTKELMHLCMR
QEAYLEALSHLQSPLDPSTLLAEVCVEQCTFMDSKMKPLWIMYSNEEAGSGGSVGIIFKN
GDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLPTGDRTGLIEVVLRSDTIANIQLN
KSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIM
IRESGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFRGYC
ERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFN
EALRESWKTKVNWLAHNVSKDNRQ
NT seq 3135 nt NT seq  +upstreamnt  +downstreamnt
atgccccctggggtggactgccccatggaattctggaccaaggaggagaatcagagcgtc
gtggttgacttcctgctgcccacaggggtctacctgaacttccctgtgtcccgcaatgcc
aacctcagcaccatcaagcagctgctgtggcaccgcgcccagtatgagccactcttccac
atgctcagtggccccgaggcctatgtgttcacctgcatcaaccagacggcggagcagcag
gagctggaggatgagcaacggcgtctgtgcgacgtgcagcccttcctgcccgtcctgcgc
ctggtggcccgcgagggcgaccgcgtgaagaagctcatcaactcgcagatcagcctcctc
atcggcaaaggcctccacgagtttgactccttgtgcgacccagaagtgaacgactttcgt
gccaagatgtgccagttctgcgaggaggcggccgcccgccggcagcagctgggctgggag
gcctggttgcagtacagcttccccctgcagctggagccctcggctcgaacctgggggcct
ggcaccctgcggctcccaaaccgggccctcctggtcaacgtcaagtttgagggcagcgag
gagagcttcaccttccaggtgtccaccaaggacgtgccgctggcgctgatggcctgtgcc
ctgcggaagaaggccacggtgttccggcagccgctggtggagcagccggaagactacacg
ctgcaggtgaacggcaggcatgagtacctgtacggcagctacccgctctgccagttccag
tacatctgcagctgcctgcacagtgggctgacccctcacctgaccatggtccattcctcc
tccatcctcgccatgcgggatgagcagagcaaccctgccccccaggtccagaaaccacgt
gccaagccgcctcccattcctgcaaagaagcccttctctgtgtccctgtggtccctggag
cagccgttctgcatcgagctcatccagggcagcaaagtgaacgccgacgagcggatgaag
ctggtggtgcaggcagggcttttccacggcaacgagatgctgtgcaagacggtgtccagc
tcggaggtgagcgtgtgctcggaacctgtgtggaagcagcggctggagttcgacatccac
atctgcgacctgccccgcatggcccgtctctgctttgcactgtacgccgtgatcgagaaa
gccaagaaggcccgctccaccaagaagaagtccaagaaggcggactgccccattgcctgg
gccaacctcatgctgtttgactacaaggaccagcttaagactggggaacgctgtctctac
atgtggccctccgtcccagatgagaagggcgagctgctgaaccccacaggcactgtgcgt
agtaaccccaacacggatagcgccgccgccctgctcatctgcctgcctgaggtggccccg
caccccgtgtactatcccgccctggagaagatcttggagctggggcggcacagtgagtgt
gtacatgtcactgaggaggagcagctgcagctgcgggaaatcctggagcggcgggggtct
ggggagctgtatgagcatgagaaggacctggtgtggaagctgcggcacgaagtccaggag
cacttcccggaggcgctagcccggctgctgctggtcaccaagtggaacaagcacgaggat
gtggcccagatgctctacctgctgtgctcctggccggagctgcctgtcctgagcgccctg
gagctgctggacttcagcttccctgattgccacgtaggctcctttgccatcaagtcgctg
cggaaactgacggacgatgagctgttccagtacttgctgcagctggtgcaggtgctaaag
tatgagtcctacctggactgcgagctgaccaaattcctgctggaccgggccctggccaac
cgcaagatcggccacttccttttctggcacctccgctccgagatgcacgtgccgtcggtg
gccctgcgcttcggcctcatcttggaggcctactgcaggggcagcacccaccacatgaag
gtgctgatgaagcagggggaagcactgagcaaactgaaggcactgaacgacttcgtcaag
ctgagctctcagaagacccccaagccccagacgaaggagctgatgcacttgtgcatgcgg
caggaggcctacctagaggccctctcccacctgcagtccccactcgaccccagcaccctg
ctggctgaagtctgtgtggagcagtgcaccttcatggactccaagatgaagcccctgtgg
atcatgtacagcaacgaggaggcaggcagcggcggcagcgtgggcatcatctttaagaac
ggggatgacctccggcaggacatgctgaccctgcagatgatccagctcatggacgtcctg
tggaagcaggaggggctggacctgaggatgaccccctacggctgcctccccaccggggac
cgcacaggcctcattgaggtggtactccgctcagacaccattgccaacatccaactcaac
aagagcaacatggcagccacagccgccttcaacaaggatgccctgctcaactggctgaag
tccaagaacccaggggaggccctggatcgagccattgaggagttcaccctctcctgtgct
ggctactgtgtggccacatatgtgctgggcatcggcgatcggcacagcgacaacatcatg
atccgagagagtgggcagctgttccacattgattttggccactttctggggaatttcaag
accaagtttggaatcaaccgtgagcgtgtcccattcatcctcacctatgactttgtccat
gtgattcagcaggggaagactaataacagtgagaaatttgaaaggttccggggctactgt
gaaagggcctacaccatcctgcggcgccatgggcttctcttcctccacctctttgccctg
atgcgggcggcaggcctgcctgagctcagctgctccaaagacatccagtacctcaaggac
tccctggcactggggaaaacagaggaggaggcgctgaagcacttccgagtgaagtttaat
gaagccctccgtgagagctggaaaaccaaagtgaactggctggcccacaacgtgtccaag
gacaacaggcagtag

DBGET integrated database retrieval system