KEGG   Macaca fascicularis (crab-eating macaque): 102143679
Entry
102143679         CDS       T02918                                 

Gene name
IL7R, IL-7RA, IL7Ra
Definition
(RefSeq) interleukin 7 receptor
  KO
K05072  interleukin 7 receptor
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04060  Cytokine-cytokine receptor interaction
mcf04068  FoxO signaling pathway
mcf04151  PI3K-Akt signaling pathway
mcf04630  JAK-STAT signaling pathway
mcf04640  Hematopoietic cell lineage
mcf05200  Pathways in cancer
mcf05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102143679 (IL7R)
   04068 FoxO signaling pathway
    102143679 (IL7R)
   04151 PI3K-Akt signaling pathway
    102143679 (IL7R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102143679 (IL7R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102143679 (IL7R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102143679 (IL7R)
  09163 Immune disease
   05340 Primary immunodeficiency
    102143679 (IL7R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcf04050]
    102143679 (IL7R)
   04090 CD molecules [BR:mcf04090]
    102143679 (IL7R)
Cytokine receptors [BR:mcf04050]
 Interleukin receptor families
  IL2 receptor family
   102143679 (IL7R)
CD molecules [BR:mcf04090]
 Proteins
  102143679 (IL7R)
SSDB
Motif
Pfam: FN3_7 fn3
Other DBs
NCBI-GeneID: 102143679
NCBI-ProteinID: NP_001271837
UniProt: Q38IC7
Position
6
AA seq 459 aa
MTILGTTFGMVFSLLQVVSGESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFE
DPDVNTTNLEFEICGALVEVKCLSFRKLQEIYFIETKKFLLIGKSNICVKVGGKSLTCKK
IDLTTIVKPEAPFDLSVIYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWMH
VNLSSTKLTLLQRNLQPEAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTPEINNSPGEMDP
ILLTISLLSFFSVALLVILACVLWKKRIKPIVWPSLPDHKKTLEHLCKKPRKNLNVSFNP
ESFLDCQIHRVDDIQARDEVEGFLQDTFPQQLEESKKQRLGGDVQSPSCPSEDVVITPES
FERDSSLRCLAGNVSACDAPILSSSRSLDCRESGKNGPHVYQDLLLSLGTTNSTLPPPFS
LQSGILTLNPVAQGQPILTSLGSNQEEAYVTMSSFYQNQ
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgacaattctaggtacaacttttggcatggttttttctttacttcaagtcgtttctgga
gaaagtggctatgcgcaaaatggagacttggaagatgcagaactggatgactactcattc
tcatgctatagccagttggaagtgaatggatcccagcactcactgacctgtgcttttgag
gacccagatgtcaacaccaccaatctggaatttgaaatatgtggggccctcgtggaggta
aagtgcctgagtttcaggaaactacaagagatatatttcattgagacaaagaaattctta
ctgattggaaagagcaatatatgtgtgaaggttggaggaaagagtctaacctgcaaaaaa
atagacctaaccactatagttaaacctgaggctccttttgacctaagtgtcatctatcgt
gaaggagccaatgactttgtggtgacatttaatacatcacacttgcaaaagaagtatgta
aaagttttaatgcacgatgtagcttaccgccaggaaaaagatgaaaacaaatggatgcat
gtgaatttatccagcacaaagctgacactcctgcagagaaacctccaacctgaagcaatg
tatgagattaaagttcgatccatccctgatcactattttaaaggcttctggagtgaatgg
agtccaagttactacttcagaactccagagatcaacaatagcccaggggagatggatcct
atcttactaaccatcagccttttgagttttttctctgtggctctgttggtcatcttggcc
tgtgtgttatggaaaaaaagaattaagcctattgtatggcccagtctccctgatcataag
aagactctggaacatctttgtaagaaaccaagaaagaatttaaatgtgagtttcaatccc
gaaagtttcctggactgccagattcatagggtggatgacattcaagctagagatgaagtg
gaaggatttctgcaagatacgtttcctcagcaactagaagaatctaagaagcagaggctt
ggaggggatgtgcagagccccagctgcccatctgaggatgtggtcatcaccccagaaagt
tttgaaagagattcatccctcagatgcctggctgggaatgtcagtgcatgtgatgcccct
atactctcctcttccaggtccctagactgcagggagagtggcaagaatgggcctcatgtg
taccaggacctcctgcttagccttgggactacaaacagcaccctgccccctccattttct
ctccaatccggaatcctgacattgaacccagttgctcaagggcagcccattcttacttcg
ctgggatcaaatcaagaagaagcgtatgtcaccatgtccagcttctaccaaaaccagtga

DBGET integrated database retrieval system