KEGG   Macaca fascicularis (crab-eating macaque): 102144085
Entry
102144085         CDS       T02918                                 

Gene name
APOC3, Apo-CIII, ApoC-III, apoCIII
Definition
(RefSeq) apolipoprotein C3
  KO
K08759  apolipoprotein C-III
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf03320  PPAR signaling pathway
mcf04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    102144085 (APOC3)
  09154 Digestive system
   04979 Cholesterol metabolism
    102144085 (APOC3)
SSDB
Motif
Pfam: Apo-CIII ApoC-I ApoA-II
Other DBs
NCBI-GeneID: 102144085
NCBI-ProteinID: XP_005579787
UniProt: P18659
Position
14
AA seq 99 aa
MQPRVLLVAALLSLLASARASEAEDTSLLGFMQGYMQHATKTAKDALTSVQESQVAQQAR
GWVTDGFSSLKDYWSTVKDKLSGFWDLNPEAKPTLAEAA
NT seq 300 nt   +upstreamnt  +downstreamnt
atgcagccccgggtactccttgttgctgccctgctgtcactcctggcctctgccagagct
tcagaggccgaggacacctcccttcttggcttcatgcagggctacatgcagcatgccacc
aagaccgccaaggatgcactgaccagcgtccaggagtcccaggtggcccagcaggccaga
ggctgggtgaccgatggcttcagttccctgaaagactactggagcaccgttaaggacaag
ttatctgggttctgggatttgaaccctgaggccaaacccactctggctgaggctgcctga

DBGET integrated database retrieval system