KEGG   Macaca fascicularis (crab-eating macaque): 102144114Help
Entry
102144114         CDS       T02918                                 

Gene name
CDK3
Definition
(RefSeq) cyclin dependent kinase 3
  KO
K02088  cyclin-dependent kinase 3 [EC:2.7.11.22]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcf01001]
    102144114 (CDK3)
Enzymes [BR:mcf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     102144114 (CDK3)
Protein kinases [BR:mcf01001]
 Serine/threonine kinases: CMGC group
  CDK family
   102144114 (CDK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like APH
Motif
Other DBs
NCBI-GeneID: 102144114
NCBI-ProteinID: XP_005585072
UniProt: A0A2K5V036
Position
16
AA seq 305 aa AA seqDB search
MDVFQKVEKIGEGTYGVVYKAKNRETGQLVALKKIRLDLEMEGVPSTAIREISLLKELKH
PNIVQLLDVVHNERKLYLVFEFLSQDLKKYMDSTPDSELPLHLIKSYLFQLLQGVSFCHS
HRVIHRDLKPQNLLINELGAIKLADFGLARAFGVPLRTYTHEVVTLWYRAPEILLGSKFY
TTAVDIWSIGCIFAEMVTRKALFPGDSEIDQLFRIFRMLGTPSEATWPGVTQLPDYKGNF
PKWTRKGLGEIVPSLEPEGRDLLMQLLQYDPSRRITAKTALAHPYFSSPEPSPAARQYVL
QRFCR
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggatgtgttccagaaggtagagaagatcggagagggcacctacggggtggtgtacaag
gccaagaacagggagacagggcagctggtggccctgaagaagatcagactggatttggag
atggagggcgtcccaagcactgccatcagggagatctccctgctcaaggaactgaagcac
cccaacatcgtccagctgctggacgtggtgcacaacgagaggaagctttatctggtgttt
gagttcctcagccaggacctgaagaagtacatggactccaccccagactcggagctcccc
ctgcacctcatcaagagctacctcttccagttgctgcagggggtgagtttctgccactca
catcgggtcatccaccgagacctgaagccccagaatctgctcatcaatgagttgggtgcc
atcaagctggctgacttcggcctggctcgagccttcggggtgcccctgcgcacctacacc
cacgaggtggtgacactgtggtatcgcgcccccgagattctcctgggcagcaagttctat
accacagctgtggatatctggagcattggttgcatctttgcagagatggtgactcgaaaa
gccctgtttcctggtgactctgagattgaccagctctttcgtatctttcgtatgctgggg
acacccagcgaagccacatggcccggggtcacccagctgcctgactataagggcaacttc
cctaagtggaccaggaagggactgggagagattgtgcccagtctggagccagagggcagg
gacctgctcatgcaactcctgcagtatgaccccagccggcggatcacagccaagactgcc
ctggcccacccgtacttctcgtcccccgagccctctccggccgcccgccagtatgtgctg
cagcgattctgccgttga

DBGET integrated database retrieval system