KEGG   Macaca fascicularis (crab-eating macaque): 102144427
Entry
102144427         CDS       T02918                                 

Gene name
APLN
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04080  Neuroactive ligand-receptor interaction
mcf04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102144427 (APLN)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102144427 (APLN)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 102144427
NCBI-ProteinID: XP_005594596
UniProt: A0A2K5TJI6
Position
X
AA seq 77 aa
MNLRLCVQALLLLWLSLTAVCGGPLMQLPYGNGLEEGNVRHLVQPRGSRNGPGPWQGGRR
KFRRQRPRLSHKGPMPF
NT seq 234 nt   +upstreamnt  +downstreamnt
atgaatctgcggctctgcgtgcaggcgctcctgctgctctggctctccttgaccgcggtg
tgtggagggcccctgatgcagcttccctatgggaatgggctggaagagggcaatgtccgc
cacctggtgcagcccagagggtcgaggaacgggccagggccctggcagggaggtcgaagg
aaattccgccgccagcggccccgcctctcccataagggacccatgcctttctga

DBGET integrated database retrieval system