KEGG   Macaca fascicularis (crab-eating macaque): 102144912
Entry
102144912         CDS       T02918                                 

Gene name
IL2RG
Definition
(RefSeq) interleukin 2 receptor subunit gamma
  KO
K05070  interleukin 2 receptor gamma
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04060  Cytokine-cytokine receptor interaction
mcf04061  Viral protein interaction with cytokine and cytokine receptor
mcf04144  Endocytosis
mcf04151  PI3K-Akt signaling pathway
mcf04630  JAK-STAT signaling pathway
mcf04658  Th1 and Th2 cell differentiation
mcf04659  Th17 cell differentiation
mcf05162  Measles
mcf05166  Human T-cell leukemia virus 1 infection
mcf05200  Pathways in cancer
mcf05321  Inflammatory bowel disease
mcf05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102144912 (IL2RG)
   04151 PI3K-Akt signaling pathway
    102144912 (IL2RG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102144912 (IL2RG)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102144912 (IL2RG)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102144912 (IL2RG)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    102144912 (IL2RG)
   04659 Th17 cell differentiation
    102144912 (IL2RG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102144912 (IL2RG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102144912 (IL2RG)
   05162 Measles
    102144912 (IL2RG)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102144912 (IL2RG)
   05340 Primary immunodeficiency
    102144912 (IL2RG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcf04050]
    102144912 (IL2RG)
   04090 CD molecules [BR:mcf04090]
    102144912 (IL2RG)
Cytokine receptors [BR:mcf04050]
 Interleukin receptor families
  IL2 receptor family
   102144912 (IL2RG)
CD molecules [BR:mcf04090]
 Proteins
  102144912 (IL2RG)
SSDB
Motif
Pfam: IL6Ra-bind EpoR_lig-bind fn3 IL4Ra_N
Other DBs
NCBI-GeneID: 102144912
NCBI-ProteinID: XP_005593949
UniProt: G7Q2Z6 A0A2K5VGQ4
Position
X
AA seq 369 aa
MLKPSLPFRSLLVLQLPLLGVALNTTILTPNGNEDATTDFFLTSMPTDSLSVSTLPLPEV
QCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKK
EIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLRKLSESQLELNWNNRFLN
HCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEW
SHPIHWGSNSSKENPFLFALEAVVISVGSMGLIISLLCVYFWLERTMPRIPTLKNLEDLV
TEYHGNFSAWSGVSKGLAESLQPDYSERLCLVSEIPPKGGALGEGPGPSPCNQHSPYWAP
PCYTLKPET
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgttgaagccatcattaccattcagatccctcttagtcctgcagctgcccctgctggga
gtggcgctgaacacgacaattctgacgcccaatgggaatgaagacgccacaactgatttc
ttcctgacctctatgcccactgactccctcagtgtttccactctgcccctcccagaggtt
cagtgttttgtgttcaatgtcgagtacatgaattgcacttggaacagcagctctgagccc
cagcctaccaacctcactctgcattattggtacaagaattcggataatgataaagtccag
aagtgcagccactatctattctctgaagaaatcacttctggctgtcagttgcaaaaaaag
gagatccacctctaccaaacatttgttgttcagctccaggacccacgggaacccaggaga
caggccacacagatgctaaaactgcagaatctggtgatcccctgggctccggagaaccta
acacttcgcaaactgagtgaatcccagctagaactgaactggaacaacagattcttgaac
cactgtttggagcacttggtgcagtaccggactgactgggaccacagctggactgaacaa
tcagtggattatagacataagttctccttgcctagtgtggatgggcagaaacgctacacg
tttcgtgtccggagccgctttaacccactctgtggaagtgctcagcattggagtgaatgg
agccacccaatccactgggggagcaatagttcaaaagagaatcctttcctgtttgcattg
gaagccgtggttatctccgttggctccatgggattgattatcagccttctctgtgtgtat
ttctggctggaacggacgatgccccgaattcccaccctgaagaacctagaggatcttgtt
actgaataccacgggaacttttcggcctggagtggtgtgtctaagggactggctgagagt
ctgcagccagactacagtgaacgactctgcctcgtcagtgagattcccccaaaaggaggg
gccctcggggaggggcctgggccctccccatgcaaccagcatagcccctactgggccccc
ccatgttacaccctgaagcctgaaacctga

DBGET integrated database retrieval system