KEGG   Macaca fascicularis (crab-eating macaque): 102145096
Entry
102145096         CDS       T02918                                 

Gene name
ADAMTS13
Definition
(RefSeq) ADAM metallopeptidase with thrombospondin type 1 motif 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mcf01002]
    102145096 (ADAMTS13)
Enzymes [BR:mcf01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     102145096 (ADAMTS13)
Peptidases and inhibitors [BR:mcf01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   102145096 (ADAMTS13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin TSP1_spondin Reprolysin_4 Reprolysin_3 Reprolysin_5 TSP1_CCN Peptidase_M10 Reprolysin_2
Other DBs
NCBI-GeneID: 102145096
NCBI-ProteinID: XP_005580570
UniProt: A0A2K5TNC6
Position
15
AA seq 1431 aa
MRQRHPRARCPSLCVAGILACGFLLGCWGPSHFQQSFLQALEPQAVSSYLISGAPLKGHP
PSPGFQRQRQRQRQRQRRAAGSILHLELLVAVGPDVFQAHQEDTERYVLTNLNIGAELLR
DPSLGAQFRVHLVKMVILTEPEGAPNITANLTSSLLSVCGWSQTINPEDDTDPGHADLVL
YITRFDLELPDGNRQVRGVTQLGGACSPTWSCLITEDTGFDLGVTIAHEIGHSFGLEHDG
APGSGCGPSGHVMASDGAAPRAGLAWSPCSRRQLLSLLSAGRARCVWDPPRPQPGSAGRQ
PEAQPGLYYSANEQCRVAFGPKAVACTFSREHLDMCQALSCHTDPLDQSSCSRLLVPLLD
GTECGVEKWCSKGRCRSLVELTPIAAVHGHWSSWGPQSPCSRSCGGGVVTRRRQCNNPRP
AFGGRACVGADLQAEMCNTQACEKTQLEFMSEQCARTDNQPLHSSPGGASFYHWGAAVPH
SQGDALCRHMCRAIGESFIMKRGDSFLDGTRCVPSGPQEDGTLSLCVSGSCRTFGCDGRM
DSQQVRDVCQVCGGDNSTCSPRNGSFTAGRAREYVTFLTVTPNLTSVYIANHRPLFTHLA
VRIGGRYVVAGKTSISSNTTYPSLLEDGRVEYRVALTKDRLPHLEEIRIWGPLQEDAEIQ
VYRRYGEEYGNLTCPDITFTYFQPKPRQAWVWAAVRGPCSVSCGAGLRWVNYSCLDQARK
ELVETARCQGSQQPPAWPEACMLEPCPPYWAVGDFGPCSVSCGGGLRERPVRCVEAQGSL
LKTLPPARCTAGAQQPAVAVEICNPQPCPARWEVSEPGPCTSASGAGPALQNETCVPGAD
GLEAPATEGPDSVDEKLPAPEPCVGMSCPAGWGHLDATSAGEEAPSPWGSIRTGAQAAHV
WTPLAGPCSVSCGRGLMELRFLCMDAALRVPVQEELCGLASKPGSRREVCQAVPCPARWQ
YKLAACSVSCGGGVMRRILYCARAHGEDEEEEILLDTQCQGLPRPDPQEACSLEPCPPRW
KVMSLGPCSASCGLGTARRSVACVQLDQGQDVEVDEAACAALVRPQASVPCLIADCTYRW
YVGTWTECSVSCGDGIQRRRDTCLGPQAQAPVLADFCQHLPKPVTVRGCWAGPCVGQGKP
NLVPHEEATAPGQTTATPAGASLEWSQAPALLFSPAPQPRRLLPGPQESSAQSSACGRQH
LEPTGTIDMRGPGQADCAVAIGRPLGEVVTLRVLESSLNCSAGDMLLLWGRLTWRKMCRK
LLGMTFSSKTNTLVVRQRCRQPGAGVLLRYGSQLAPETFYRECDMQLFGPWGEIVSPSLS
PATSKAGGCRLFINVAPHARIAIHALATNMDNGTKGANASYISIRDIHSLRTTTFHGQQV
LYWESESSQAEMEFSEDFLKAQASLRGQYWTLQSWVPEGQDPQSWKGKEGT
NT seq 4296 nt   +upstreamnt  +downstreamnt
atgcgccagcgtcacccccgggcaagatgcccttccctctgtgtggccggaatccttgcc
tgtggctttctcctgggctgctggggaccctcccatttccagcagagttttcttcaggca
ttggagccacaggctgtgtcttcttacttgatctctggtgctcccttaaaaggccaccct
ccctcccccggcttccagaggcagaggcagaggcagaggcagaggcagaggcgggctgca
ggcagcatcctacacctggagctgctggtggccgtgggccccgatgtcttccaggctcac
caggaggacacagagcgctacgtgctcaccaacctcaacatcggggcagaactgcttcgg
gacccgtccctgggggctcagtttcgggtgcacctggtgaagatggtcattctgacagag
cccgagggtgctccaaatatcacagccaacctcacctcgtccctgctgagcgtctgtggg
tggagccagaccatcaaccccgaggacgacacggatcctggccacgctgacctggtcctc
tatatcacgaggtttgacctggagttgcctgatggtaaccggcaggtgcggggagtcacc
cagctgggtggtgcctgctccccaacctggagctgcctcattaccgaggacactggcttc
gacctgggagtcaccatcgcccatgagatcgggcacagcttcggcctggagcacgacggc
gcgcctggcagcggctgcggccccagcggacacgtgatggcttcagacggcgccgcgccc
cgcgctggcctcgcctggtccccctgcagccgccggcagctgctgagcctgctcagcgca
ggacgggcgcgctgcgtgtgggaccccccgcggcctcagcctgggtccgcggggcgccag
ccggaggcgcagcctggcctctactacagcgccaacgagcagtgccgcgtggccttcggc
cccaaggcagtcgcctgcaccttctccagggagcacttggatatgtgccaggccctctcc
tgccacacagacccgctggaccaaagcagctgcagccgcctcctcgttcctctcctggac
gggacagaatgtggcgtggagaagtggtgttccaagggtcgctgccgctccctggtggag
ctgacccccatagcagcggtacatgggcactggtctagctggggtccccaaagtccttgc
tcccgctcctgcggaggaggtgtggtcaccaggaggcggcagtgcaacaaccccagacct
gcctttggggggcgtgcgtgtgttggtgctgacctccaggccgagatgtgcaacactcag
gcctgtgagaagacccagctggagttcatgtcggaacagtgtgccaggaccgacaaccag
ccgctgcactcctcccctggcggtgcctccttctaccactggggcgctgctgtaccacac
agccaaggggatgctctgtgcaggcacatgtgccgggcaattggcgagagcttcatcatg
aagcgtggagacagcttcctggatgggacccggtgtgtgccaagtggcccccaggaggat
gggaccctaagcctgtgcgtgtcgggcagctgcaggacatttggctgtgatggcaggatg
gactcccagcaggtacgggacgtgtgccaggtatgtggtggagacaacagcacgtgcagc
ccacggaacggctctttcacagctggaagagcgagagaatatgtcacatttctgacggtt
acccccaacctgaccagtgtctacattgccaaccacaggcctctcttcacacacttggcg
gtgaggattggagggcgctacgttgtggctgggaagacgagcatctcctctaacaccacc
tacccctccctcctggaggatggccgtgtcgagtacagagtggccctcaccaaggaccgg
ctgccccacctggaggagatccgcatctggggacccctccaggaagatgctgagatccag
gtttacaggcggtacggcgaggagtatggcaacctcacctgcccagacatcactttcacc
tacttccagcctaagccgcggcaggcctgggtgtgggccgctgtgcgtgggccctgctcg
gtgagctgtggggcagggctgcgctgggtaaactacagctgcctggaccaggccaggaag
gagttggtagagactgcccggtgccaagggagccagcagccaccagcgtggccagaggcc
tgcatgctcgaaccttgccctccgtactgggcggtgggagacttcggcccatgcagtgtc
tcctgtgggggtggcctgcgggagcggccagtgcgctgcgtggaggcccagggcagcctc
ctgaagacgttgcccccagcccggtgcacagcaggggcccagcagccagctgtggcagtg
gaaatctgcaacccccagccctgccccgccaggtgggaggtgtcagagcccggcccatgc
acatcagccagtggagcaggcccggccttgcagaacgagacctgtgtgccgggggcagat
ggcctggaggctccagcgactgaagggcctgactccgtagatgagaagctgcctgcccct
gagccgtgtgtcgggatgtcatgccctgcaggctggggccatctggatgccacctctgca
ggggaggaggctccctccccatggggcagcatcaggacgggggctcaagctgcacacgtg
tggacccctctggcagggccgtgctccgtctcctgcgggcgaggcctgatggagctgcgt
ttcctgtgcatggacgctgccctcagggtgcctgtccaggaggagctgtgtggcctggca
agcaagcctggaagccggcgggaggtctgccaggctgtcccgtgccctgctcggtggcag
tacaagctggcggcctgcagcgtgagctgtgggggaggggtcatgcggaggatcctgtat
tgtgcccgggcccatggggaggatgaggaggaggagatcctgttggacacccaatgccag
gggctgcctcgcccagacccccaggaggcctgcagcctggagccctgcccacctaggtgg
aaagtcatgtcccttggcccatgttcggccagctgtggccttggcactgctaggcgctcg
gtggcctgtgtgcagctcgaccaaggccaggacgtggaggtggacgaggcggcctgtgcg
gcactggtgcggccccaggccagcgtcccctgtctcattgctgactgcacctaccgctgg
tatgtcggcacctggacggagtgctctgtttcctgtggggatggcatccagcgccggcgt
gacacctgcctcggaccccaggcccaggcgcctgtgctggctgatttctgccagcacttg
cccaagccagtgactgtgcgtggctgctgggctgggccctgtgtgggacaggggaagccc
aacctggtgcctcacgaagaagccactgctccaggacagaccacagccacccctgctggt
gcctccctggagtggtcccaggccccggccctgctcttctccccggctccccagcctcgg
cggctcctgcccgggccccaggaaagctcggcgcagtccagtgcctgtggcaggcagcac
cttgagccaacaggaaccattgacatgcgaggaccagggcaggcagactgtgcagtggcc
attgggcggcccctcggggaggtggtgaccctccgtgtccttgagagttctctcaactgc
agtgcgggggacatgttgttgctttggggccggctcacctggaggaagatgtgcaggaag
ctattgggcatgactttcagctccaagaccaacacgctggtggtgaggcagcgctgcagg
cagccgggagccggggtgctgctgcggtatgggagccagcttgctcctgaaaccttctac
agagaatgtgacatgcagctctttgggccctggggtgaaatcgtgagcccctcgctgagt
ccagccacgagtaaggcagggggctgccggctcttcattaacgtggctccgcacgcccgg
attgccatccatgccctggctaccaacatggacaatgggaccaagggagccaatgccagc
tacatctcgatccgggacatccacagcttgaggaccacaacgttccatgggcagcaggtg
ctctactgggagtcagagagcagccaggctgagatggagttcagcgaggacttccttaag
gctcaggccagcctgcggggccagtactggaccctccaatcatgggtaccggaggggcag
gaccctcagtcctggaagggaaaggaagggacctga

DBGET integrated database retrieval system