KEGG   Macaca fascicularis (crab-eating macaque): 102146720Help
Entry
102146720         CDS       T02918                                 

Gene name
GSTM2, GSTM2-2
Definition
(RefSeq) glutathione S-transferase mu 2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf00480  Glutathione metabolism
mcf00980  Metabolism of xenobiotics by cytochrome P450
mcf00982  Drug metabolism - cytochrome P450
mcf00983  Drug metabolism - other enzymes
mcf01524  Platinum drug resistance
mcf05200  Pathways in cancer
mcf05204  Chemical carcinogenesis
mcf05225  Hepatocellular carcinoma
mcf05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    102146720 (GSTM2)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102146720 (GSTM2)
   00982 Drug metabolism - cytochrome P450
    102146720 (GSTM2)
   00983 Drug metabolism - other enzymes
    102146720 (GSTM2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    102146720 (GSTM2)
   05204 Chemical carcinogenesis
    102146720 (GSTM2)
   05225 Hepatocellular carcinoma
    102146720 (GSTM2)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    102146720 (GSTM2)
  Drug resistance
   01524 Platinum drug resistance
    102146720 (GSTM2)
Enzymes [BR:mcf01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102146720 (GSTM2)
Transporters [BR:mcf02000]
 Other Transporters
  Pores ion channels [TC:1]
   102146720 (GSTM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_C GST_C_3 GST_C_6 GST_C_2 GST_N_3 GST_N_2 Bromo_TP DUF4414
Motif
Other DBs
NCBI-GeneID: 102146720
NCBI-ProteinID: NP_001274584
UniProt: Q9TSM4
Position
1
AA seq 218 aa AA seqDB search
MPMTLGYWNIRGLAHSIRLLLEYTGSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNL
PYLIDGTHKITQSNAILRYIARKHNLCGETEKEKIREDILENQLMDNRMQLARLCYDPDF
EKLKPEYLEGLPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPN
LKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGNK
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgcccatgacactggggtactggaacatccgcgggctggcccactccatccgcctgctc
ctggaatacacaggctcaagttacgaggaaaagaagtacacaatgggggatgctcctgac
tatgacagaagccagtggctgaatgaaaaattcaagctgggcctggactttcccaatctg
ccctacttgattgatgggactcacaagatcacccagagcaacgccatcctgcgctacatt
gcccgcaagcacaacctgtgtggggagaccgaaaaggagaagattcgggaagacattttg
gagaaccagcttatggacaaccgcatgcagctggccagactctgctatgacccagatttt
gagaaactgaagccagaatacctggagggacttcctgaaatgctgaagctctactcacag
tttctggggaagcagccatggtttcttggggacaagatcacctttgtggatttcatcgct
tatgatgtccttgagagaaaccaagtatttgagcccagctgcctggatgccttcccaaac
ctgaaggacttcatctcccgatttgagggcttggagaagatctctgcctacatgaagtcc
agccgcttcctcccaagacctgtgttcacaaagatggctgtctggggcaacaagtaa

DBGET integrated database retrieval system