KEGG   Macaca fascicularis (crab-eating macaque): 102146844
Entry
102146844         CDS       T02918                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchoring protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcf01009]
    102146844 (AKAP5)
Protein phosphatases and associated proteins [BR:mcf01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     102146844 (AKAP5)
SSDB
Motif
Pfam: WSK NINJA_B
Other DBs
NCBI-GeneID: 102146844
NCBI-ProteinID: XP_005561525
Position
7
AA seq 427 aa
METTVSEIHVENKDEKRSAEGSPGADRQKEKASMLCFKRRKKAAKALKPKVGSEAADVAR
KCPQEAGASDQPEPPRGAWASLKRLVTRRKRSESSKQQKLLEAEVQPAINTEDADLSKKK
AKSRLKIPCIKFPRGPKRSNHSKIIEDSDCSIKVQEEAEILDIQTQTPLNDQATKAKSTQ
DLSEGISRKDGDEVCESNVSNSITSGEKVISVELGLDDGHSAIQTGTLILEEIETVKEKQ
DVQPQQAGPLETSETDHQQTVLSDVPPLPAIPAQQIMEEASNNILKSAPNGKDYESREIV
AEETKPKDTELSQESDFKENGITEEKSKLEESKRIEPIAIIITDTEISEFDVKKSKNVPK
QFLISTENEQVGVFANDNGFEDRTSEQYETLLIETASSLVKNAIQLSVEQLVNEMASDDN
KINNLLQ
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggaaaccacagtttcagaaattcatgtagaaaacaaggatgagaagagatcagcagaa
ggtagtcctggggctgacagacagaaggaaaaggcatccatgctttgcttcaagagaaga
aagaaagcagctaaagcactgaagcccaaagttggctctgaagctgctgatgtggcaagg
aagtgtccccaagaagcaggagcttctgatcagccagagcccccacggggggcctgggcc
tcactcaaacgtcttgtaacacgcaggaaaaggtcagagtcttcaaagcagcaaaagtta
ttggaggctgaagtgcaacctgcaataaacactgaggatgctgatctttctaagaaaaag
gcaaaatctagacttaagattccctgcataaaattcccaagagggccaaaaaggagtaat
cattccaaaattatagaagactcagactgcagcatcaaagtccaggaagaagctgaaatt
ttggatatacaaacacagaccccattgaatgatcaggcaacaaaggctaagtcaacccag
gatctaagtgaaggcatctcacggaaagatggtgatgaagtctgtgaatcaaatgtgagc
aatagcataacttctggagagaaagtgatttcagtagaacttggattagatgatgggcat
tctgctattcaaacgggaactctaatccttgaagaaattgaaacggtcaaggaaaaacaa
gatgttcaaccccagcaagcaggcccacttgaaacttcagaaacagaccatcagcaaaca
gtactttctgatgttccacctttacctgcaatcccagctcaacaaattatggaagaagcc
agtaacaatatcctaaaaagtgcaccaaatgggaaagactatgaaagtagagagattgta
gctgaagaaactaagccaaaagatactgaattgagccaagaatcagattttaaagaaaat
gggatcactgaagagaagtccaaattagaagaaagcaaacgaatagagccaattgctatt
attattacagacactgaaatcagtgaatttgatgttaagaaatcaaaaaatgtccctaag
caattcttaatttcaactgaaaatgagcaagtaggggtttttgctaatgataatggtttt
gaggatagaacttcagaacaatatgaaacactcttaattgaaacagcctcttctcttgtc
aagaatgctattcagttgtcagtagaacagctggttaatgaaatggcctctgatgataat
aaaataaacaatcttctacagtga

DBGET integrated database retrieval system