KEGG   Methyloceanibacter caenitepidi: GL4_0014Help
Entry
GL4_0014          CDS       T03636                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mcg  Methyloceanibacter caenitepidi
Pathway
mcg00071  Fatty acid degradation
mcg00072  Synthesis and degradation of ketone bodies
mcg00280  Valine, leucine and isoleucine degradation
mcg00310  Lysine degradation
mcg00362  Benzoate degradation
mcg00380  Tryptophan metabolism
mcg00620  Pyruvate metabolism
mcg00630  Glyoxylate and dicarboxylate metabolism
mcg00640  Propanoate metabolism
mcg00650  Butanoate metabolism
mcg00900  Terpenoid backbone biosynthesis
mcg01100  Metabolic pathways
mcg01110  Biosynthesis of secondary metabolites
mcg01120  Microbial metabolism in diverse environments
mcg01130  Biosynthesis of antibiotics
mcg01200  Carbon metabolism
mcg01212  Fatty acid metabolism
mcg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mcg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GL4_0014
   00630 Glyoxylate and dicarboxylate metabolism
    GL4_0014
   00640 Propanoate metabolism
    GL4_0014
   00650 Butanoate metabolism
    GL4_0014
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GL4_0014
   00072 Synthesis and degradation of ketone bodies
    GL4_0014
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GL4_0014
   00310 Lysine degradation
    GL4_0014
   00380 Tryptophan metabolism
    GL4_0014
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GL4_0014
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GL4_0014
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    GL4_0014
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcg04147]
    GL4_0014
Enzymes [BR:mcg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     GL4_0014
Exosome [BR:mcg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GL4_0014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: BAQ15485
UniProt: A0A0A8JY36
Position
14040..15221
Genome map
AA seq 393 aa AA seqDB search
MKDADIVIVSAARTPVGAFGGSLASVPAHTLGETAIRAALERAGVDAGDVDEVIMGQVLT
AGEGQNPARQAAIAAGVPKEATAFGINQVCGSGLRSVALGAQQIASGDADIIVAGGQENM
SLSPHVAHLRNGTKMGDVKFIDTMIKDGLWEAFNGYHMGNTAENVAKQWQLTRDEQDAFA
VASQNKAEAAKKGGKFKDEIAPVTIKTRKGDVVVDEDEYIREGATIEGVAGLRPAFDKEG
TVTAGNASGINDGAAAVVLMSAEEAKKRGLTPLARIASWAVAGVDPSIMGTGPIPASRKA
LEKAGWKVADLDLIEANEAFAAQALAVNKDMGWDGAKVNVNGGAIAIGHPIGASGTRVLV
TLLHEMQKTDAKKGLATLCIGGGMGVAMCVERD
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacgcagatattgtaatcgttagcgcggcgcggacgcccgtcggagctttcggc
ggttcccttgcaagcgttcccgcccacaccctgggcgagacggccattcgggccgccctt
gaacgcgctggcgtcgatgccggcgacgtcgacgaagtcatcatgggccaggtgcttacg
gccggcgaaggtcagaacccggctcggcaggcggcgatcgccgcgggcgtgcccaaggaa
gccaccgccttcggcatcaaccaggtctgcggttcgggcctgcgctccgtcgctctcggc
gctcagcagatcgcctcgggcgacgccgatatcatcgtggccggcggccaggagaacatg
agcctgtccccccacgtcgcgcacctgcgcaacggcaccaagatgggcgacgtcaaattc
atcgacaccatgatcaaggacggcctgtgggaagccttcaacggctaccacatgggcaac
accgccgagaacgtcgccaagcagtggcagctgacccgcgacgagcaggacgcctttgcg
gtcgcctctcagaacaaggccgaagcggccaagaagggcggcaagttcaaggacgagatc
gcgcccgtgaccatcaagacccgcaagggcgacgtggtcgtggacgaggacgagtacatc
cgcgaaggcgccaccattgagggcgtcgccggcctgcgcccggccttcgacaaggaaggc
accgtgaccgcgggcaacgcatcgggcatcaatgacggtgccgccgcagtggtcctgatg
tccgccgaggaagccaagaagcgcggtctgaccccgcttgcccgcatcgcctcctgggcg
gtcgccggcgtcgatccctccatcatgggcaccggtcccatcccggcttcgcgcaaggcg
ctggaaaaggccggatggaaagtcgccgacctcgacctcattgaagccaatgaggccttc
gccgcgcaggcgctggccgtgaacaaggacatgggttgggacggcgctaaggtgaacgtc
aatggcggcgccattgccatcggtcacccgatcggcgcatcgggcacacgcgttctcgtc
acgctcctgcacgagatgcagaagacggacgcgaagaagggcctggccacgctgtgcatc
ggcggcggcatgggcgttgccatgtgcgtggagcgcgactaa

DBGET integrated database retrieval system