KEGG   Methyloceanibacter caenitepidi: GL4_0107Help
Entry
GL4_0107          CDS       T03636                                 

Definition
(GenBank) succinyl-CoA ligase [ADP-forming] alpha chain
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
mcg  Methyloceanibacter caenitepidi
Pathway
mcg00020  Citrate cycle (TCA cycle)
mcg00640  Propanoate metabolism
mcg00660  C5-Branched dibasic acid metabolism
mcg01100  Metabolic pathways
mcg01110  Biosynthesis of secondary metabolites
mcg01120  Microbial metabolism in diverse environments
mcg01130  Biosynthesis of antibiotics
mcg01200  Carbon metabolism
Module
mcg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mcg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mcg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GL4_0107
   00640 Propanoate metabolism
    GL4_0107
   00660 C5-Branched dibasic acid metabolism
    GL4_0107
Enzymes [BR:mcg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     GL4_0107
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-ProteinID: BAQ15578
UniProt: A0A0A8JXR4
Position
96542..97414
Genome map
AA seq 290 aa AA seqDB search
MSVLVNKNTRVICQGFTGSQGTFHTEQAIAYGTKMVGGVTPGKGGTTHLDLPVFDTVRDA
VAATGATASAIYVPPPFAADAILEAIDAGIELAVCITEGVPVLDMVKVKRALIGSGTRLI
GPNCPGIITPGECKIGIMPGHIHKPGRVGIVSRSGTLTYEAVAQTTAVGFGQTTCIGIGG
DPVNGTNFIDALSLFLEDDATEAIIMIGEIGGSAEEEAAEFLVKAGNKKPIVGFVAGATA
PPGRRMGHAGAVISGGKGDAKSKIEAMQDAGIVVSHSPAALGTTLAGIFS
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtcctcgtcaataagaacacgcgcgtcatctgtcagggtttcacgggctctcaa
ggcacctttcacacagaacaagccattgcctacggcaccaagatggtcggcggcgtcacc
cccggcaaaggcggcacgacacatctcgatctgccggtcttcgacacggtgcgcgatgcc
gtcgcggcgacgggcgcgaccgcgtcggccatctacgttccaccgccctttgcggccgat
gccatcctcgaggcgatcgacgcgggcatcgagcttgcggtctgcatcaccgagggcgtt
ccggtcctcgacatggtcaaagtcaagcgcgccctcatcggatcgggcacgcgcctgatc
ggcccgaactgcccgggcatcatcacgccgggcgagtgcaagatcggcatcatgccgggg
cacatccacaaacccggacgtgtcggcatcgtctcccggtccggtacgctgacctacgag
gccgttgcgcagaccaccgctgttggatttggccagaccacctgcatcggcatcggcggc
gaccccgtaaacgggacgaatttcatcgacgcgctctcgctcttcctcgaggacgacgcc
accgaagccatcatcatgatcggcgagatcggcggcagcgccgaggaagaagccgcggaa
ttcttggttaaggccggcaacaagaagccgatcgtaggcttcgtggccggcgcgactgcg
ccccccggacgccgcatgggacatgccggtgccgttatttcgggcggcaagggcgacgca
aagagcaaaattgaggcaatgcaggacgccggcatcgtggtgtcccattcccctgcagcg
cttggaacaacgcttgcaggaatattcagctaa

DBGET integrated database retrieval system