KEGG   Methylorubrum extorquens CM4: Mchl_0402Help
Entry
Mchl_0402         CDS       T00809                                 

Definition
(GenBank) ApaG domain protein
  KO
K06195  ApaG protein
Organism
mch  Methylorubrum extorquens CM4
Brite
KEGG Orthology (KO) [BR:mch00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    Mchl_0402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354 LTD
Motif
Other DBs
NCBI-ProteinID: ACK81338
UniProt: B7L060
Position
complement(390753..391145)
Genome map
AA seq 130 aa AA seqDB search
MYKAETRGIMVTVEPRFVEEESSPGESRYFFAYTVEIVNNGSEQVQLRSRHWRIIDGRGA
CQEVRGAGVVGKQPVLEPGESFSYTSGCPLTTPDGLMAGSYTMSTIGGESFEAEIPAFSL
DSPHLRRVVH
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaggccgagacgcgcggcatcatggtgacggtggagccccgtttcgtcgaggag
gagtcctcgccgggcgagagccgttacttctttgcctacacggtcgagatcgtgaacaac
ggcagcgaacaggtgcagcttcgctcgcgccactggcggatcatcgacggacgcggcgcc
tgccaggaggtgcgcggcgcgggcgtcgtcggcaagcagccggttctcgagccgggcgag
tcgttcagctacaccagcggctgcccgctcaccacgccggacggcctgatggccggcagc
tacacgatgtccacgattggcggcgagagcttcgaggcggagattccggccttctcgctg
gactcgccccatctgcgccgcgtcgtccattga

DBGET integrated database retrieval system