KEGG   Methylorubrum extorquens CM4: Mchl_0685Help
Entry
Mchl_0685         CDS       T00809                                 

Definition
(GenBank) putative deoxyribonuclease
  KO
K01144  exodeoxyribonuclease V [EC:3.1.11.5]
Organism
mch  Methylorubrum extorquens CM4
Brite
KEGG Orthology (KO) [BR:mch00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Mchl_0685
Enzymes [BR:mch01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Mchl_0685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 UvrD_C_2 AAA_19 Viral_helicase1 PIF1 AAA_16 AAA_33 AAA NB-ARC NACHT AAA_22 ATPase_2 AAA_5 TsaE AAA_11 UvrD_C AAA_18 PhoH
Motif
Other DBs
NCBI-ProteinID: ACK81607
UniProt: B7KZ77
Position
679586..680707
Genome map
AA seq 373 aa AA seqDB search
MAESSLPTRFAPQQDEALKAIARWRKEGGSQVFRLFGYAGTGKTTLARRIADDIDGPVVY
GAFTGKAASVMRQKGCDDAATIHSLIYRTKEGDEGGPTFSLNRSGPAAKADLIVIDECSM
VDSDLGHDLLSFDKPVLVLGDPAQLPPVRGGGFFTEAEPDVMLTDVHRQAADDPIVRMAM
TIREGGRLEVGEYGQSRVVRRRDIDPAQVLDCDQVLVGLNRTRRLYNNRLRELAGHTDPM
PSVGEKLVCLRNDRTKGLLNGSTWTVQALRAPPRPDTVRLDVVPEDDPAARRRAVDIKVL
RQVIEGSEEEIPLFLRRETDEFTYGYALTVHKAQGSQWDKVVLFDESYAFREHRARWLYT
GLTRAAQAITVVV
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggccgagtcctcgcttcccacccgcttcgccccgcaacaggacgaggcgctcaaagcc
atcgcccgctggcgcaaggaaggcggctcccaggtcttccgcctgttcggctatgccggc
accggcaagaccacgctcgcccgccgcatcgccgacgacatcgacggcccggtcgtctac
ggcgccttcaccggcaaggcggcctcggtcatgcgccagaagggctgcgacgacgcggcg
acgattcactcgctgatctaccgcaccaaggagggcgacgagggcggcccgaccttcagc
ctcaatcgctccggcccggcggccaaggccgacctcatcgtcatcgacgagtgctcgatg
gtcgattccgacctcggccacgacctcctctcgttcgacaagccggtgctggtgctgggc
gatcccgcccagttgcctccggtgcgcggcggcggcttcttcaccgaggccgagcccgac
gtgatgctcaccgacgtccaccggcaggccgccgacgacccgatcgtgcgcatggcgatg
acgatccgcgagggcgggcggctcgaagtcggcgagtacggccagagccgggtggtgcgc
cgccgcgatatcgacccggcccaggtgctcgattgcgatcaggtgttggtcggcctcaac
cggacgcggcgcctctacaacaaccgcctgcgggaactcgccgggcacaccgacccgatg
ccctcggtcggcgagaagcttgtctgcctgcgcaacgaccgcaccaagggcctgctcaac
ggctcgacctggacggtgcaggccctgcgcgccccgccccgccccgacacggtccgcctc
gacgtggtgcccgaggacgacccggcggcgcgccgccgcgccgtggacatcaaggtgctg
cggcaggtgatcgagggttcggaggaggagatcccgctgttcctgcgccgcgagaccgac
gagttcacctacggctacgcgctcacggtccacaaggcgcagggctcgcaatgggacaag
gtggtcctgttcgacgagtcctacgcgtttcgcgagcaccgcgcccgctggctctatacc
gggctgactcgggcggcgcaggcgatcaccgtggtggtgtag

DBGET integrated database retrieval system