KEGG   Methylorubrum extorquens CM4: Mchl_0816Help
Entry
Mchl_0816         CDS       T00809                                 

Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
mch  Methylorubrum extorquens CM4
Pathway
mch00780  Biotin metabolism
mch01100  Metabolic pathways
Module
mch_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:mch00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Mchl_0816
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mch01007]
    Mchl_0816
Enzymes [BR:mch01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     Mchl_0816
Amino acid related enzymes [BR:mch01007]
 Aminotransferase (transaminase)
  Class II
   Mchl_0816
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase Aminotran_5 Cys_Met_Meta_PP DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: ACK81735
UniProt: B7L0L2
Position
834955..836106
Genome map
AA seq 383 aa AA seqDB search
MSPNPSNSLDAFAGEKLAGLEASALRRRLAVTARGPEAAAERGGRSLVSFSCNDYLGLAH
DPRVIAAATEALARYGAGAGASRLVTGNSPPLAALEERLARHKGKEAALVFGSGYLANLG
IAPALVGAGDLILIDELGHSCLFAGAAMSRAQTVRFAHNDVAQLRALLAEHRGTARRALI
LTERVFSMDGDRAPLPEILALAGEYDAWTLVDDAHGLGVVEPGQRAPLEMGTLSKTLGSY
GGYLCASQPVIDLLTSRARSLVYTTGLPPASAAAALKALDIVETEPERAARPLALARRFT
ARLGLPEAMSPIVPVLIGAAEAALALSTALEARGFLVVAIRPPTVAPGTARLRVAFSAAH
DEGQVDALAEALIELAPESVRAG
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccgaacccctcgaacagcctcgacgccttcgccggagaaaagctcgccggcctg
gaagccagcgccctgcggcgccgtctggccgtcaccgcccgcggccccgaggcggcggcc
gagcgcgggggccgcagcctcgtctcgttctcctgcaacgattatctcggcctcgcccac
gatccgcgggtgatcgcggcggccactgaagcactcgcgcgctacggcgcgggcgcgggc
gcctcgcggctggtgaccggcaattcccccccgctcgcggcgctggaggagcggctcgcc
cggcacaagggcaaggaggccgccctcgtcttcggctcgggctatctcgccaatctcggc
atcgccccggccctcgtcggcgcgggcgacctgatcctgatcgacgaactcggccattcc
tgcctgttcgcgggagcggcgatgtcgagggcgcagaccgtgcgctttgcccataacgac
gtcgcgcagttgcgcgcgctgctcgccgagcatcgcggcacggcgcggcgggcgctgatc
ctgaccgagcgggtgttcagcatggatggcgaccgggcgccgctcccagagatcctggcg
cttgccggcgaatacgacgcctggacgttggtggacgatgcacacggcctcggcgtggtc
gagcccggccagcgggcgccgctcgaaatgggcacgctctcgaaaacgctgggctcctat
ggcggctatctctgtgcctcgcagcccgtgatcgacctgctgaccagccgggcgcgcagc
ctcgtctacaccaccggcctgccgccggcctccgccgccgcggcgctcaaagccctcgac
atcgtcgagacggagccggagcgcgccgcccggccgctggcgctcgcgcgccgcttcacc
gcgcgtctcggcctgcccgaggcgatgagcccgatcgtgccggtgctcatcggcgcggcg
gaggcggcgctggctctctcgacggcgttggaggcgcgcggcttcctcgtggtggcgatc
cgtccgccgacggtcgcccccggcaccgcccgtctgcgggtcgccttctcggcagcgcat
gacgaggggcaggtcgatgccctcgccgaggcgctgatcgaattggcgccggagagcgtc
cgcgccggctga

DBGET integrated database retrieval system