KEGG   Methylobacterium extorquens CM4: Mchl_2277Help
Entry
Mchl_2277         CDS       T00809                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
mch  Methylobacterium extorquens CM4
Pathway
mch00230  Purine metabolism
mch01100  Metabolic pathways
Module
mch_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mch00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Mchl_2277
Enzymes [BR:mch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Mchl_2277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_16 TsaE AAA_18 AAA ABC_tran AAA_22 CPT cobW AAA_30 DUF3619
Motif
Other DBs
NCBI-ProteinID: ACK83123
UniProt: B7KYB4
Position
2389830..2390501
Genome map
AA seq 223 aa AA seqDB search
MTQDATQGRPDIARRGLILILSSPSGAGKTTLTRAIAQRPEWGLDLSISVTTRSRRPSEI
DGRDYRFIDREAFEDLRTRDDLLEWAEVHGNFYGTPRRPVEKTLSQGRDMIFDIDYQGTR
QVRQRLQDDVVTVFILPPSFAELRNRLERRAEDAPETIERRLANARNEMQRWSEYDYVIV
NDDLDESFRALQSILAAERLKRTRRTGLPGFVDGLLAEAGRSA
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaggatgccacccaaggcagaccggatatcgcccggcgcgggctgattctgatc
ctgtcctcgccctcgggcgcgggcaagacgacgctgacccgcgccatcgcccagcggccc
gaatggggcctcgatctgtcgatctcggtgacgacgcgctcgcgccgcccctcggagatc
gacgggcgcgactaccgcttcatcgaccgcgaggcgttcgaggatcttcgcacgcgcgac
gacctgctcgaatgggccgaggtccacgggaatttctacggcacgccgcgccgcccggtc
gagaagaccctgtcccaaggccgggacatgatcttcgacatcgactaccagggcacccgc
caggtccggcagcggctgcaggacgacgtggtgacggtgttcatcctgccgccgagcttc
gccgagttgcgcaaccgcttggagcgccgggcggaagacgcacccgagaccatcgagcgg
cggctggccaacgcccgcaacgagatgcagcgctggagcgagtacgactacgtcatcgtc
aacgacgacctcgacgagtccttccgcgcgcttcagtcgatcctggccgccgagcgcctc
aagcgcacccgccgcaccggcctgccgggcttcgtcgatgggcttctggccgaggccggg
cggagcgcttga

DBGET integrated database retrieval system