KEGG   Methylobacterium extorquens CM4: Mchl_2941Help
Entry
Mchl_2941         CDS       T00809                                 

Definition
(GenBank) 1,4-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mch  Methylobacterium extorquens CM4
Pathway
mch00500  Starch and sucrose metabolism
mch01100  Metabolic pathways
mch01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mch00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mchl_2941
Enzymes [BR:mch01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Mchl_2941
Exosome [BR:mch04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mchl_2941
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase_C CBM_48 Alpha-amylase Glyco_hydro_70 DUF4687 AMPK1_CBM
Motif
Other DBs
NCBI-ProteinID: ACK83780
UniProt: B7KQL6
Position
3103140..3105494
Genome map
AA seq 784 aa AA seqDB search
MTALDEKAAARNEGQAAANVPNRSGSTEAPRAPRSSDALGGEGAPRVGRSASQARDGHLH
PDAIAAVMAADHGDAFGVLGPHQVAPGTWEVRAILPEAKAARLVTGGQSIAFERVHPDGF
YVASVKSEGRPLYEIEVEAWDGTSTRRHDPYGFGPSLEQSEIDGLRLIGSNLVYRVLGAH
AGELDGIAGFRFAVWAPNARRVSVVGDFNDWDGRRHPMRLWLNGGVWELFVPGLKAGQNY
KFEIRGPDGSVLPLKADPVAFRAQHPPQTASVLQSLNEPQWNDAAWMDTRGEKDPRHAAM
SVYEVHLGSWARVPDEGNRYLTYKELSDRLIPYVKDLGFTHIELLPITEYPFDGSWGYQP
VSLFAPTSRFGTPDDFVDFVNAAHAAGIGVMLDWVPGHFPLDAHGLGLFDGTHLYEHADP
RQGFHQDWGTYIYNFGRVEVSAFLTANARFWLEHYHLDGLRVDAVASMLYLDYSRRAGEW
IPNQYGGNENLDAINFLRKTNEATYSHAPGTITVAEESTSWPGVSHPTYTGGLGFGFKWN
MGWMHDTLKYMSEDPIHRRYHHHNLTFGLLYAFSENFVLPLSHDEVVHGKGSLLGKMPGD
RWQKFANLRAYFGFMWGHPGKKLLFMGGEFGQEREWNHNQSLDWHLLDDPLHGGVKDLIR
DLNHVYTSTPALYSRDVEASGFQWLVADDSDNSVIAWARKGKAEGEVAIVVSNFTPVPRE
GYRVGVPTAGFYREAINSDAERYGGSNVGNMGGVQSQAEQSHGQPHSLSLTLPPLSTLIL
IREG
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgacggctctggacgagaaggccgcggctcgtaacgaggggcaggcggccgccaacgtc
ccgaacaggtcaggctcgaccgaggcgccgcgcgcgccccggtcgtcggatgcgcttggc
ggcgagggggctccccgtgtgggccgctccgcctcgcaagcgcgcgatggccacctccat
cccgatgccattgcggccgtgatggcggccgatcacggcgacgcgttcggcgtcctcggg
ccgcatcaggttgcgcccggtacgtgggaggtccgtgcgatcctgccggaggcgaaggcg
gcccgcctcgtcacgggcgggcagagcatcgcgttcgagcgcgttcatcccgacgggttc
tacgttgcgagcgtgaagagcgagggtcggcccctctacgagatcgaggtcgaggcgtgg
gacggcaccagcacccgccgtcacgatccctatggcttcggcccgtcgctcgaacagagc
gagatcgacggcctacggctgatcggcagcaacctcgtctatcgcgtgctcggcgcgcat
gcgggtgagctcgacggcatcgccgggttccgcttcgcggtctgggcaccgaatgcccgc
cgcgtcagcgtcgtcggcgacttcaacgattgggacggccggcgccacccgatgcggctg
tggctcaatggcggcgtctgggagctgttcgtgccgggtctcaaggccgggcagaactac
aagttcgagatccgtggccccgacgggtccgtgctgccgttgaaggccgatccggtcgcc
ttccgcgcccagcatccgccgcagacggcctcggtgctccagagtctcaacgagccgcaa
tggaacgatgcggcctggatggatacgcgcggtgagaaggatccgcgccacgccgccatg
tcggtctacgaggtccatctcggctcgtgggcgcgggtgccggacgagggcaaccgctac
ctgacctacaaggagctgtccgaccggctgatcccgtacgtgaaggacctcggcttcacg
catatcgagcttctgccgatcaccgagtacccgttcgacggctcctggggctaccagccg
gtctcgctgttcgcgccgaccagccgcttcggcacgcccgacgacttcgtcgatttcgtc
aacgcggcgcatgcggccggcattggcgtgatgctcgattgggtgccggggcacttcccc
ctcgacgcccacggcctcggcctgttcgacggcacgcatctctacgagcatgccgatccg
cgccagggcttccaccaggattggggcacctacatctacaattttggtcgggtcgaggtg
tccgccttcctcacggccaatgcccgcttctggctcgagcactaccatctcgacggcctg
cgcgtggatgcagtcgcgtcgatgctctacctcgactactcgcgccgcgcgggcgagtgg
attccgaaccagtacggcggcaacgagaatctcgacgccatcaacttcctgcgcaagacc
aacgaggccacctacagccacgcgccgggcaccatcacggtggccgaggaatcgacctcg
tggccgggcgtgtcgcacccgacctacacgggcggtctcggcttcggcttcaagtggaac
atggggtggatgcacgacaccctgaaatacatgtcggaggatccgatccaccggcgttac
caccaccacaacctaaccttcggcctgctctacgccttctcggaaaacttcgtgctgccg
ctctcccatgacgaggtggtgcacgggaagggctcgctgctcggcaagatgccgggcgac
cgctggcagaagttcgccaatctacgcgcctatttcggcttcatgtggggtcatcccggc
aagaagctgctctttatgggcggcgagttcggccaggagcgcgagtggaaccacaaccag
tcgctcgactggcacctgctcgacgatcccctgcatggcggcgtgaaggatctgatccgc
gacctcaaccacgtctacacctcgaccccggcgctctattcgcgcgacgttgaggccagt
ggcttccagtggctggtggcggacgattccgacaactcggtcatcgcctgggcgcgcaag
ggcaaggcagagggcgaagtcgccatcgtcgtctcgaactttacgccggtgccgcgtgag
ggctaccgcgtcggcgtaccgacggccggtttctaccgcgaggcgatcaactcggacgcc
gagcgctatggcggctcgaatgtcggcaatatgggcggcgtgcagagccaagccgagcag
agccacggccagccgcattcgctgagcctgaccctgccgccgctctcgaccctgatcctg
attcgcgagggctga

DBGET integrated database retrieval system