KEGG   Methylobacterium extorquens CM4: Mchl_3568Help
Entry
Mchl_3568         CDS       T00809                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mch  Methylobacterium extorquens CM4
Pathway
mch00071  Fatty acid degradation
mch00072  Synthesis and degradation of ketone bodies
mch00280  Valine, leucine and isoleucine degradation
mch00310  Lysine degradation
mch00362  Benzoate degradation
mch00380  Tryptophan metabolism
mch00620  Pyruvate metabolism
mch00630  Glyoxylate and dicarboxylate metabolism
mch00640  Propanoate metabolism
mch00650  Butanoate metabolism
mch00900  Terpenoid backbone biosynthesis
mch01100  Metabolic pathways
mch01110  Biosynthesis of secondary metabolites
mch01120  Microbial metabolism in diverse environments
mch01130  Biosynthesis of antibiotics
mch01200  Carbon metabolism
mch01212  Fatty acid metabolism
mch02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mch00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mchl_3568
   00630 Glyoxylate and dicarboxylate metabolism
    Mchl_3568
   00640 Propanoate metabolism
    Mchl_3568
   00650 Butanoate metabolism
    Mchl_3568
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Mchl_3568
   00072 Synthesis and degradation of ketone bodies
    Mchl_3568
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mchl_3568
   00310 Lysine degradation
    Mchl_3568
   00380 Tryptophan metabolism
    Mchl_3568
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mchl_3568
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mchl_3568
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Mchl_3568
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mch04147]
    Mchl_3568
Enzymes [BR:mch01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Mchl_3568
Exosome [BR:mch04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mchl_3568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ACK84388
UniProt: B7KVI0
Position
complement(3754782..3755990)
Genome map
AA seq 402 aa AA seqDB search
MPEAYIYDHVRTPRGRGKPDGSLHEVTALRLAETALRALKDRNGLDTRQVDDVVLGCVDP
VGEAGGDIARAAALVADYGTHVPGVQINRFCASGLDAINFAAAQVMAGQHDLTVGGGVES
MSRVGLGASGGAWPVDPAIAVKSYFMPQGVSADLIATKYGFSRDDCDAYAVESQKRSAQS
WGEGLFKNSVVPVRDINGITLLDRDEHMRPTTDMQSLASLKPSFVQMGQMGGFDAVAVDA
HPDVEAVRHVHHAGNSSGIVDGAAAVLIGSREAGDAAGLRPRARIRAFANIGSDPALMLT
GPVDVTKKVLARAGMSLSDIDLFEINEAFASVVLRFHQAFDLDPAKVNVNGGAIAMGHPL
GATGAMILGTVLDELERTGKERALVTLCIGAGMGTATIIERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaggcctacatctacgatcacgtccgcaccccccgcggccgcggcaagccggat
ggttcgctgcacgaggtgacggcgttgcgcctcgccgagacggcgttgcgcgcgctcaag
gaccgcaacggcctcgacacgcggcaggtggacgacgtggtgctcggctgcgtcgatccg
gtcggcgaggccggcggcgacatcgcccgcgccgccgcgctcgtggctgattacggcacc
cacgtgcccggcgtgcagatcaaccgcttctgcgcctcgggcctcgacgccatcaacttc
gccgcggcgcaggtcatggccggccagcacgatcttaccgtcggcggcggtgtcgaatcg
atgagccgcgtcggcctcggcgcctcgggcggcgcctggccggtcgatccggcgatcgcg
gtcaaatcctacttcatgccgcagggcgtctcggccgacctcatcgccaccaagtacggg
ttcagccgcgacgattgcgacgcctacgccgtcgagtcgcagaagcgctcggcccaatcc
tggggcgagggcctgttcaagaactccgtcgtgccggtgcgggacatcaacggcatcacc
ctgctcgaccgcgacgagcacatgcggccgacgaccgacatgcagtcgctggcgagcctg
aaaccgtccttcgtgcagatgggccagatgggcggcttcgacgcggtagccgtcgatgcc
cacccggatgtcgaggcggtccgtcacgtccaccatgccggcaactcgtcgggcatcgtg
gatggcgcggcggcggtgctgatcggctcgcgcgaggccggcgacgccgcgggcctgcgg
ccccgcgcccgcatccgggccttcgccaatatcggctccgatccggcgctgatgctgacc
ggcccggtcgatgtcacgaagaaggtgctggcgcgggccggcatgagcctgtccgacatc
gacctgttcgagatcaacgaggccttcgcctcggtggtcctgcgcttccatcaggccttc
gacctcgacccggcgaaggtgaacgtcaacggcggcgccatcgccatgggtcatccgctg
ggtgccacgggcgcgatgatcctcggcaccgtgctcgacgagttggagcgcaccggcaag
gagcgggcgctcgtgaccctgtgcatcggcgctggcatgggcaccgccacgatcatcgag
cgggtgtga

DBGET integrated database retrieval system