KEGG   Methylorubrum extorquens CM4: Mchl_3602Help
Entry
Mchl_3602         CDS       T00809                                 

Definition
(GenBank) Nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
mch  Methylorubrum extorquens CM4
Brite
KEGG Orthology (KO) [BR:mch00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Mchl_3602
Enzymes [BR:mch01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     Mchl_3602
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: ACK84422
UniProt: B7KW65
Position
3796374..3797219
Genome map
AA seq 281 aa AA seqDB search
MTDLSDHKPFIAACVQMRGGRDPAVNREAAVQAVREAARRGAAYVQTPETTSLIERDRTA
LFEKVGPQESDATLAALREVARAEQIVLQIGSLAIREGEKIANRAFLIDAAGEIQAAYDK
LHLYDVDLPNGESWRESATYSGGDCAVVAQTPLASLGLTICYDIRFPALYRALAEAGATV
MTAPACFTRQTGEAHWHILQRARAIETGSFMISAAQGGRHEDGRETFGHSLIVDPWGRIL
AEAEGDAPGIILAEIDLARVADARARIPTLSHARSFGVRRA
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgacggacctgtccgaccataagcccttcatcgccgcctgcgtgcagatgcgcggcggg
cgtgatccggccgtcaaccgcgaggccgccgtgcaggcggtgcgcgaggcggcccgccgg
ggtgccgcctatgtgcagacgcccgagacgacctcgctgatcgagcgcgaccgcaccgcc
ctgttcgaaaaggtcgggccgcaggagagcgacgccacgctcgccgccctgcgcgaggtc
gcgcgggcggaacagatcgttctgcaaatcggatcgctggcgatccgcgagggcgagaag
atcgccaaccgcgcctttctgatcgacgccgcgggcgagatccaagcggcttacgacaag
ctccacctctacgacgtcgatctgcccaacggcgagagctggcgcgaatcggcgacctat
tcgggcggcgactgcgccgtggtcgcgcagacgccgctcgccagcctcgggctgacgatc
tgctacgacatccgctttcccgctctctaccgggcgttggccgaggcgggcgccacggtg
atgaccgcgccggcctgtttcacccgccagaccggcgaggcgcactggcacatcctgcag
cgggcgcgggccatcgagaccggctccttcatgatctcggcggcgcaaggcggccggcac
gaggacggacgcgagaccttcggccactcgctcatcgtcgatccctggggccgcatcctc
gccgaggctgagggtgacgcgccgggcatcatcctcgccgagatcgacctcgcgcgggtc
gcggatgcacgcgcccgcattcccaccctgtcccacgcgcgcagcttcggcgtgcgccgc
gcctga

DBGET integrated database retrieval system