KEGG   Methylobacterium extorquens CM4: Mchl_3777Help
Entry
Mchl_3777         CDS       T00809                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mch  Methylobacterium extorquens CM4
Pathway
mch00071  Fatty acid degradation
mch00072  Synthesis and degradation of ketone bodies
mch00280  Valine, leucine and isoleucine degradation
mch00310  Lysine degradation
mch00362  Benzoate degradation
mch00380  Tryptophan metabolism
mch00620  Pyruvate metabolism
mch00630  Glyoxylate and dicarboxylate metabolism
mch00640  Propanoate metabolism
mch00650  Butanoate metabolism
mch00900  Terpenoid backbone biosynthesis
mch01100  Metabolic pathways
mch01110  Biosynthesis of secondary metabolites
mch01120  Microbial metabolism in diverse environments
mch01130  Biosynthesis of antibiotics
mch01200  Carbon metabolism
mch01212  Fatty acid metabolism
mch02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mch00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mchl_3777
   00630 Glyoxylate and dicarboxylate metabolism
    Mchl_3777
   00640 Propanoate metabolism
    Mchl_3777
   00650 Butanoate metabolism
    Mchl_3777
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Mchl_3777
   00072 Synthesis and degradation of ketone bodies
    Mchl_3777
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mchl_3777
   00310 Lysine degradation
    Mchl_3777
   00380 Tryptophan metabolism
    Mchl_3777
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mchl_3777
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mchl_3777
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Mchl_3777
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mch04147]
    Mchl_3777
Enzymes [BR:mch01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Mchl_3777
Exosome [BR:mch04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mchl_3777
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt B12-binding SpoVAD CMD
Motif
Other DBs
NCBI-ProteinID: ACK84596
UniProt: B7KX71
Position
3989873..3991057
Genome map
AA seq 394 aa AA seqDB search
MAASEDIVIVGAARTPVGSFAGAFGSVPAHELGATAIKAALERAGVSPDDVDEVIFGQVL
TAAAGQNPARQAAIAAGIPEKATAWGLNQVCGSGLRTVAVGMQQIANGDAKVIVAGGQES
MSLSPHAQYLRGGQKMGDLKLVDTMIKDGLWDAFNGYHMGQTAENVAQAFQLTREQQDQF
AVRSQNKAEAARKEGRFKEEIVPVTVKGRKGDTVVDTDEYIRDGATVEAMAKLKPAFAKD
GTVTAANASGLNDGAAALVLMSASEAERRGITPLARIVSWATAGVDPKVMGTGPIPASRK
ALEKAGWKPADLDLIEANEAFAAQALAVNKDMGWDDEKVNVNGGAIAIGHPIGASGARVL
ITLLHELKRRDAKKGLATLCIGGGMGVAMCVERV
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggcagccagtgaagatatcgtcattgtcggtgcggcgcgtacgcccgtcggatcgttc
gccggtgccttcggttccgtgccggcccacgaactcggcgccacggcgatcaaggccgca
ctggagcgcgcgggcgtttcgccggacgacgtggacgaggtgatcttcggccaggtgctc
accgctgccgccgggcagaacccggcccgtcaggccgccatcgccgcaggcatccccgag
aaggcgaccgcctggggtctcaatcaggtctgcggctcgggcctgcgcaccgtcgcggtc
ggcatgcagcagatcgccaacggcgacgccaaggtgatcgtggccggcggccaggaatcg
atgtcgctaagcccgcacgcccagtacctgcgcggcggccagaagatgggcgatctcaag
ctcgtcgacaccatgatcaaggacggcctgtgggacgccttcaacggctaccacatgggc
cagaccgccgagaacgtcgcccaagccttccagctcacccgcgagcagcaggaccagttc
gcggtccgctcgcagaacaaggccgaggccgcccgcaaggagggccgcttcaaggaagag
atcgtccccgtcaccgtgaagggccgcaagggcgacacggtcgtcgacaccgacgagtac
atccgtgacggcgccaccgtcgaggcgatggccaagctcaagcccgccttcgccaaggac
ggcaccgtgaccgcggccaacgcctcgggcctgaacgacggcgccgccgcgctggtgctg
atgtcggcctccgaggccgagcgccggggcatcacgccgctggcccggatcgtgtcctgg
gcgaccgcgggcgtcgatcccaaggtgatgggcacgggcccgatcccggcctcgcgcaag
gccctggagaaggccggctggaagcccgccgacctcgacctgatcgaggcgaacgaggct
ttcgccgctcaggcgctggcggtgaacaaggacatgggctgggacgacgagaaggtgaac
gtcaatggcggcgccatcgccatcggccacccaatcggtgcctccggcgcccgcgtcctc
atcaccctgctgcacgagctgaagcgccgcgacgccaagaagggcctcgccacgctctgc
atcggcggcggcatgggtgtcgccatgtgtgtcgagcgggtctga

DBGET integrated database retrieval system