KEGG   Methylobacterium extorquens CM4: Mchl_4862Help
Entry
Mchl_4862         CDS       T00809                                 

Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
mch  Methylobacterium extorquens CM4
Pathway
mch00010  Glycolysis / Gluconeogenesis
mch00052  Galactose metabolism
mch00500  Starch and sucrose metabolism
mch00520  Amino sugar and nucleotide sugar metabolism
mch00521  Streptomycin biosynthesis
mch01100  Metabolic pathways
mch01110  Biosynthesis of secondary metabolites
mch01120  Microbial metabolism in diverse environments
mch01130  Biosynthesis of antibiotics
mch01200  Carbon metabolism
Module
mch_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mch00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mchl_4862
   00052 Galactose metabolism
    Mchl_4862
   00500 Starch and sucrose metabolism
    Mchl_4862
   00520 Amino sugar and nucleotide sugar metabolism
    Mchl_4862
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mchl_4862
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Mchl_4862
Enzymes [BR:mch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Mchl_4862
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: ACK85627
UniProt: B7KSF9
Position
complement(5174685..5175686)
Genome map
AA seq 333 aa AA seqDB search
MFEFPVLIGDIGGTNARFGLIETRGAPPRLLSREATHGHPDPSAAIRASLAQGGGPAPRS
AILAIAGRVDAPAVQLTNADWLVDAAAIARDFGLARVALVNDYVPVAAGAAGIAPDDLTP
IGPSRGDASGPRLVLGPGTGFGAAALIPYEDRLAIVSTEAGHTDLGPTDAEEFEIWPAVE
RVEGRVTVETLLSGPGLARICAAIRAVRAGGDGSLCDPAEITSSGLSGEDPHAHAALALF
SKLLGRVCGDLALTFLATGGVYIGGGIAPRIVSVLREGAFREAFERKAPFAEQMRIIPTS
VITVKDPAFSGLAALASESERFVYHGHAWTPQK
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgttcgaattcccggtgctgatcggcgatatcggcgggaccaatgcccgcttcggcctg
atcgaaacgcggggggcgccgccccgtctcctctcgcgcgaggcgacgcacggccatccc
gatccgagcgcggcgatccgggcctccctggcgcagggcggcgggcccgcgccgcgctcg
gcgatcctggcgatcgcgggccgggtcgatgcgccggcggtccagctcaccaacgcggac
tggctggtggacgccgccgcgatcgcccgtgatttcgggctcgcgcgggtcgcccttgtc
aacgattacgtgccagtcgccgcgggcgcggccggcatcgcgcccgacgacctcacgccg
atcggtccaagtcgcggtgacgcaagcgggccgcgcctcgtgctcgggccgggcaccggc
ttcggcgccgccgccctgatcccctacgaggaccgcctcgccatcgtctcgacggaggcc
ggccacaccgatctcgggccgaccgacgcggaggagttcgagatctggccggcggtcgag
cgcgtcgaggggcgggtcacggtggagacgctgctctccggtcccggtctcgcccggatc
tgtgcggcgatccgcgcggtgcgggcgggcggcgacggttcgctgtgcgacccggccgag
atcacgagcagcggcctctcgggcgaggatccgcatgcacacgccgcgctcgcgctgttc
agcaagctgctcggccgggtatgcggggatctggcgctgaccttccttgccaccggcggg
gtctatatcggcggcggcatcgccccgcggatcgtctccgtcctgcgggagggtgcgttc
cgcgaggctttcgagcgcaaggcgcctttcgccgagcagatgcgcatcatccccaccagc
gtcatcaccgtgaaggaccccgccttcagcggcctcgcggccctggcgagcgagagcgag
cgcttcgtctatcacgggcatgcctggacaccgcagaagtaa

DBGET integrated database retrieval system