KEGG   Methylobacterium extorquens CM4: Mchl_4910Help
Entry
Mchl_4910         CDS       T00809                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mch  Methylobacterium extorquens CM4
Pathway
mch00260  Glycine, serine and threonine metabolism
mch00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mch01100  Metabolic pathways
mch01110  Biosynthesis of secondary metabolites
mch01130  Biosynthesis of antibiotics
mch01230  Biosynthesis of amino acids
Module
mch_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mch00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mchl_4910
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mchl_4910
Enzymes [BR:mch01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mchl_4910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth ThiG PcrB
Motif
Other DBs
NCBI-ProteinID: ACK85675
UniProt: B7KSK7
Position
complement(5232080..5232922)
Genome map
AA seq 280 aa AA seqDB search
MTARIDAAFARCRAEGRAALVTYVMAGDPDPETSLKVLEALPKAGADIVEFGLPFTDPMA
DGPAIQAAGLRALKAGQDLRGTLALVRRFREGDDQTPVVLMGYYNPIHTYGVPHFLEDAQ
AAGIDGLIVVDLPPEEDEELCLPALEKGLAFIRLATPTTDEARLPAVLANTAGFVYYVSI
TGVTGTATPDFGRVSQAVSRITAHTNLPVVVGFGVKTGAHAAEIARGADGVVVGSALVDA
LARSLEPGDRAGSGTVEAVASLVRELAQGVRSAAKAPAGA
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcccgcatcgatgccgccttcgcccgctgccgcgcggaaggacgtgccgccctc
gtcacctacgtgatggcgggcgatcccgatccggagacctcgcttaaggtgctcgaagcc
ctaccgaaggcgggggccgacatcgtcgagttcggcctgcccttcaccgatcccatggcc
gacgggccggcgatccaggcggcgggtctgcgggcgctgaaggcgggccaggatctgcgc
ggcaccctcgccctcgtccgccgcttccgcgaaggcgacgaccagacgcccgtggttctg
atgggctactacaacccgatccatacctacggcgtgccccacttcctggaggatgcgcag
gcggccggcatcgacggtctgatcgtcgtcgatctgccgccggaggaggacgaggagctc
tgcctgccggcgctcgaaaaggggctcgccttcatccgcctcgcgaccccgaccacggac
gaggcccgcctgccggcggttctcgcgaacaccgcgggcttcgtctactacgtgtcgatc
accggcgtgaccggcacggcgacccccgatttcggccgggtgtcgcaggcggtcagccgg
atcacggcgcatacgaacctgcccgtcgtcgtcggcttcggcgtgaagaccggcgcgcac
gccgccgagatcgcccgcggcgccgacggcgtggtggtgggctcggccctcgtcgatgcc
ctggcccgcagcctcgaacccggcgaccgggccgggagcggcacggtggaggcggtcgcc
tccctggtgcgcgagctggcgcagggggtccgcagcgccgccaaagcgccggccggggcc
tga

DBGET integrated database retrieval system