KEGG   Methylorubrum extorquens CM4: Mchl_5336Help
Entry
Mchl_5336         CDS       T00809                                 

Definition
(GenBank) gamma-glutamyltransferase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
mch  Methylorubrum extorquens CM4
Pathway
mch00430  Taurine and hypotaurine metabolism
mch00460  Cyanoamino acid metabolism
mch00480  Glutathione metabolism
mch01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mch00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Mchl_5336
   00460 Cyanoamino acid metabolism
    Mchl_5336
   00480 Glutathione metabolism
    Mchl_5336
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mch01002]
    Mchl_5336
Enzymes [BR:mch01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     Mchl_5336
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     Mchl_5336
Peptidases and inhibitors [BR:mch01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   Mchl_5336
CD molecules [BR:mch04090]
 Proteins
  Mchl_5336
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: ACK86096
UniProt: B7KWL9
Position
complement(5717226..5718842)
Genome map
AA seq 538 aa AA seqDB search
MPSRLFAEASAPRGALAQSRQGMVTSPHELASEAGREVLRGGGNAIEAAIAINATLCVTY
PHFCGLGGDAFMIVSDRNGASFTLSGIGQAAAKLPQNGRPIPLRGPGSAITAAAAVDTWE
QAFTYSQRAWGGRQSWKGLFQRAITYAAEGFPLTPSQRFWANFRAKEIGNWPDIVRVFTA
EGRIPEAGETFRQPDLARTLTMLAENGGRDFYVGELAQRIARGLEQAGAPLTADDLARCR
ARNESALRVPYRGGELISLRPPTQGLTTLEIMGVLDRYDVASLPEGSADYYHLLVEAVKL
AFIDRNRFIADPDFVDVPVERLLSAPHLDAQARSIDPRKAAPWPDVFKTGDTVFIGAADP
DGNCVSLLQTVYFDWGSGVVAGDTGILWHNRGASFSVDANSINVLRPGKRPFHTLNPGMY
FKNGRPNLLYGTQGADGQPQTLSAVLTRLIDYGMDPLTALARPRFLLGKTFSDSRDSLKL
ELDAGQAVFEELKARGHEISPIPAQSPLAGHPGAIQIEDDGHFVGAHDPRSDGLALGL
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgccgagccgtctcttcgctgaagcgagcgccccgcgcggcgctctcgcccagtcccgc
cagggcatggtgacgagcccgcacgaactcgccagcgaagccgggcgggaggtgctgcgg
gggggcggcaacgcgatcgaggcggcgatcgccatcaacgccaccctctgcgtgacctac
ccgcatttctgcggcctgggcggtgacgcgttcatgatcgtcagcgatcgcaacggtgcg
agcttcaccctgtccggcatcgggcaggcggcggcgaagctgccgcagaacggacggccg
attccattgcgcggacccggctcggcgatcaccgccgcggccgccgtcgatacctgggag
caagccttcacctacagccagcgggcctggggcgggcggcaatcttggaaggggctgttc
cagcgcgcgatcacctatgcggcagagggctttcccctgacgccctcgcaacgcttctgg
gcgaacttccgcgccaaggagatcggcaactggcccgatatcgtgcgcgtgttcacagcc
gaaggccgcatccccgaggccggggagacgtttcggcagcccgatctcgcccgcacactg
acgatgctcgcggagaatggcggccgcgacttctacgtgggcgagttggcccagcggatc
gcgcgggggctggagcaggcgggcgcgcccctgacggcggacgacctcgcccgctgccgc
gcacgcaacgaaagcgcgctgcgcgtgccctaccggggcggggaactcatcagcctgcgc
ccgccgacacagggcctcaccaccctcgaaatcatgggcgttctcgaccgctacgacgtg
gcttcccttcccgagggcagcgccgattactaccacctcctcgtcgaggcggtgaagctg
gccttcatcgaccgcaaccgcttcatcgccgatcccgatttcgtcgatgtgcccgtcgag
cggctgctatcggccccgcacctcgatgcgcaggcccggagcatcgatccgcgcaaggct
gcgccctggcccgatgtcttcaagaccggtgataccgtcttcatcggagcggccgacccg
gacggcaattgtgtcagcctgctgcagacggtctatttcgattggggcagcggcgtcgtc
gcgggcgataccggcatcctctggcacaatcgcggtgcgtccttcagcgtggacgccaac
agcatcaacgtgctgcgccccggaaagcgcccgttccacacgctcaatcccggcatgtac
ttcaagaacggccgtccgaacttgttgtacggaacgcagggcgcagatgggcaaccacag
accctgtcggcggtgctgacgcgcctgatcgattacgggatggatcccctcaccgccctc
gcgcgccctcggttccttctgggcaagaccttctcggacagccgcgacagcctgaagctc
gaactcgatgcgggtcaggccgtgttcgaagagctgaaggcgcgagggcacgagatcagc
cccattcccgcccagagccccctagccggccatcccggcgcaatccaaatcgaggatgac
ggccacttcgtcggcgcccacgatccgcgcagtgatggcttggccctcggcctttga

DBGET integrated database retrieval system