KEGG   Momordica charantia (bitter melon): 111005113Help
Entry
111005113         CDS       T05045                                 

Definition
(RefSeq) probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH4 isoform X1
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
mcha  Momordica charantia (bitter melon)
Pathway
mcha03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:mcha00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    111005113
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mcha03041]
    111005113
Enzymes [BR:mcha01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     111005113
Spliceosome [BR:mcha03041]
 Complex C
  Other components
   Step II factors
    111005113
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C DEAD AAA_22 AAA_30 ABC_tran AAA_19 DUF2075 cobW T2SSE MMR_HSR1 Helicase_RecD AAA_16 AAA_29 Sigma54_activ_2 FtsK_SpoIIIE AAA_33 ATPase_2 DAP3
Motif
Other DBs
NCBI-GeneID: 111005113
NCBI-ProteinID: XP_022132197
Position
Unknown
AA seq 702 aa AA seqDB search
MAQLPILQFEEKIIETVEQNPVVVVIGETGSGKSTQLSQMLHRRGYTKSGIIGVTQPRRV
AAVSVARRVAEELGVHLGEEVGYAIRFEDRTSERTRIKYLTDGVLLRENLSDPELGQYSV
IILDEAHERSLNTDILMGLVKRLIRLRISNLKVLITSATLDGDKVSKFFSNCPVLTVPGK
LYPVEILYGNERPKSYLESCLKTAIDIHTQEPEGDVLIFMTGQDDIEKLVSKLEEKVYNL
EEGSCMDAIILPLHGSLPPELQVRVFSRPPPNCRRFIVATNIAETSLTVDGVVYVIDSGY
VKQRQYNPSTGMYSLDVVQISKVQANQRAGRAGRTLPGKCYRLYTSMDYQEEFLDVTVPE
IQRSSLAGSVLYLKSLDLPDIDILRFDFLDPPTSESLEDALKQLYLIDAIDENGSITSIG
RTMAELPLEPSLSRTLIEANEYGCISQALTVAAMLSAETTLLPNRRKNTDKKRKHSSLDL
PDGSGLGDHIQLLQIFEVWDQKKYDVSWCKDHDLQVRGMLFVKDVRKQLCQIMQKIAKGS
LDVWTSRNQKESQQEYWNLRKALCVGYANQLAERMIHHNGYRTLNFKPQVVQVHPSSVLK
PDEEGKFADYVVYHELITTSRPYMRNVCAVQVDWVMPTLNKVKNLNVNKLSGSSVDLTSE
TVEGNVINSPTKEDGSAASTLDGRENKIQAARERFLARRGKK
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagcttccaatcctccaatttgaggagaaaatcatcgaaacagtggagcagaat
ccagtagtagtcgtaattggagaaacaggctctgggaagagcactcagctctctcaaatg
ctccaccggagaggatatacaaagtccggtataatcggcgtcactcagcctcgccgagtt
gccgctgtttctgttgctagacgagttgcagaggagctcggcgtgcatcttggcgaggaa
gttggatatgccattcgtttcgaggacagaacttcagaaaggactcgaataaaatacctc
actgatggagtcctccttcgcgaaaatctttctgatcccgagcttggtcaatattcagtt
atcatattggacgaggctcacgagagaagcctaaatacagacatattgatggggctcgtg
aaacgattaatcagactgcgtatctccaatttgaaggttcttatcacttcagcaactcta
gatggggacaaagtatccaagttcttttcaaattgccctgtgctaacagtgcctggaaag
ttgtatcccgttgagattttgtatggcaatgaacgtccaaagagctaccttgaatcatgt
ttaaaaacagctattgatatacatacccaagaaccagagggggatgttctcattttcatg
actggacaggatgacatagagaagttagtatcaaagttggaggaaaaagtttacaattta
gaagaaggatcttgcatggatgctataattctcccccttcatggttcattgccaccagaa
ctgcaggtgcgtgtattcagtcgtccacctccaaattgtaggagatttattgtagcaaca
aatattgctgaaacttctttgactgttgatggtgttgtgtatgtcattgattctggttat
gtcaagcaacggcaatacaatccatcaactggcatgtactcccttgatgttgtacaaatt
agcaaagtgcaagcaaatcaacgtgctgggcgagctggaagaacgctccctgggaagtgc
tataggttgtacacttccatggattatcaagaggaattcttggatgtaacagttcctgaa
atacaacgctcttctcttgctggcagcgttctttatttgaaatcattggaccttccagat
atcgatattctcagatttgattttcttgatccccccacctctgagtctttagaagatgca
ctgaagcagctatatcttattgacgctattgatgaaaatggatctattactagtattggg
cgaaccatggctgagcttccactagaaccttcactctcacgaaccttgatagaggcgaat
gagtatggttgtatatcccaggctttgactgttgctgcaatgttatcagcagagacgaca
ttgcttcctaatcgcagaaagaatactgataagaagaggaagcacagttccttggacctt
cctgatggttcaggcttgggtgatcacatccaattgctacagatatttgaggtctgggat
caaaagaagtatgatgttagctggtgtaaagaccacgatttgcaggtaagagggatgttg
tttgtcaaagatgtacgaaaacagctctgtcaaataatgcagaaaatagcaaaaggatca
ttagacgtatggacatccagaaaccaaaaggagagtcaacaagagtactggaatttgagg
aaggctttatgtgttggttatgccaatcaacttgcagagagaatgattcatcacaatggc
tatcgaactcttaattttaagccccaagttgttcaggtgcatccatcgtcggttctgaag
ccagatgaagaggggaaatttgctgactatgttgtgtaccatgaactgattacaacatca
cgaccctatatgcgcaatgtatgtgcagtacaggttgattgggttatgcccactttaaac
aaggttaagaatttaaacgtaaacaaattaagtggtagcagtgttgatcttacgagtgag
acggtggagggcaatgtcataaactctccaacgaaagaagatggtagtgctgcatcaact
cttgatggccgtgaaaacaaaattcaggctgctagagaacgatttcttgcacggagaggg
aaaaaatga

DBGET integrated database retrieval system