KEGG   Momordica charantia (bitter melon): 111006098Help
Entry
111006098         CDS       T05045                                 

Definition
(RefSeq) heat shock cognate 70 kDa protein 2-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
mcha  Momordica charantia (bitter melon)
Pathway
mcha03040  Spliceosome
mcha04141  Protein processing in endoplasmic reticulum
mcha04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:mcha00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    111006098
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    111006098
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111006098
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcha01009]
    111006098
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mcha03041]
    111006098
   03009 Ribosome biogenesis [BR:mcha03009]
    111006098
   03110 Chaperones and folding catalysts [BR:mcha03110]
    111006098
   04131 Membrane trafficking [BR:mcha04131]
    111006098
   03051 Proteasome [BR:mcha03051]
    111006098
   03029 Mitochondrial biogenesis [BR:mcha03029]
    111006098
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcha04147]
    111006098
Protein phosphatases and associated proteins [BR:mcha01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     111006098
Spliceosome [BR:mcha03041]
 Complex B
  Other components
   Prp19 complex
    111006098
 Complex C
   Prp19-CDC5 complex
    111006098
Ribosome biogenesis [BR:mcha03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    111006098
Chaperones and folding catalysts [BR:mcha03110]
 Heat shock proteins
  HSP70 / DNAK
   111006098
Membrane trafficking [BR:mcha04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    111006098
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    111006098
Proteasome [BR:mcha03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    111006098
Mitochondrial biogenesis [BR:mcha03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    111006098
Exosome [BR:mcha04147]
 Exosomal proteins
  Proteins found in most exosomes
   111006098
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 111006098
NCBI-ProteinID: XP_022133538
Position
Unknown
AA seq 648 aa AA seqDB search
MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN
QVAMNPINTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIAGPGDKPMIVVNYKGEEKQFAA
EEISSMVLTKMREIAEAYLGSSIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD
NRLVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFY
TTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQDFF
NGKELCKSINPDEAVAYGAAVQAAILCGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLI
PRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQI
NVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKLVQEAEKFKAEDEEHKK
KVESKNTLENYAYNMRNTIRDEKIGGKLAPADKKKIEDAVEQAIQWLDSNQLAESDEFED
KMKELESLCNPIIAKMYQGAGGDMGGAMDDDAPPSGGSGAGPKIEEVD
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atggcgggaaagggcgagggtccggccattggtatcgatctcggtacgacttactcgtgt
gttggagtatggcagcacgatcgtgttgagattattgcgaatgatcaggggaatcgaacg
acgccgtcttatgttggtttcaccgatagcgagcgtctcatcggcgatgctgctaagaac
caggtcgctatgaatcccatcaacactgtcttcgatgcgaaacggttgattggaaggaga
ttttccgacccctcggtccagagcgatatgaaattgtggccgttcaaggtcatcgccggt
ccaggtgacaaaccgatgatcgtcgtcaactataaaggcgaagagaagcaatttgccgct
gaagaaatctcatccatggtcctcaccaaaatgcgtgagatagctgaagcttacctcggc
tcgtctatcaagaacgcggtcgtcaccgttcctgcctacttcaatgactcccagcgtcag
gccacaaaagatgccggagtcattgccggccttaatgtcatgaggatcattaacgagcct
acagctgcagccattgcatatggactcgacaaaaaggcgaccagcgttggcgagaagaat
gtactgatatttgatctgggtggaggaacatttgatgtctccctcctcacaattgaggaa
ggtatttttgaggtgaaggcaacggccggtgacactcatcttggaggtgaggacttcgac
aacagattggttaaccacttcgttcaagaattcaagaggaagaataagaaggacatcagt
ggaaacccgagggctctcaggagattgaggactgcttgtgagagggccaagaggaccctt
tcatccaccgctcaaactacaatcgagattgattctttgtacgagggaatcgatttctac
acaaccatcactcgtgctaggtttgaggagctcaacatggacctgttcaggaagtgtatg
gagccagttgagaagtgtttgagagatgcaaagatggacaaaagcagtgtccatgatgtt
gtccttgttggtggctctacgaggattcctaaggtgcagcagctattgcaggatttcttc
aatggcaaggaactgtgcaagagtatcaatcctgatgaggcagttgcttacggggctgca
gttcaagctgccatattgtgtggtgaaggaaatgagaaagttcaggatcttctgcttctg
gatgtcactcctctgtcccttggtttggagactgctggaggtgtgatgacagttttgatc
cccaggaataccaccatacccaccaagaaggagcaagtcttctccacatactcagataac
caacccggtgttctcattcaggtctatgagggtgaaaggacgagaacccgagataacaat
ttgttgggcaagttcgagctttctggcattcctccagctccgagaggtgttccccagatc
aacgtttgcttcgacattgatgccaatggtatccttaatgtttctgcagaggacaagacc
accggacagaagaacaagatcaccattaccaacgacaaaggaaggttgtcgaaagaggag
atcgagaaactggttcaggaagcagaaaaattcaaggccgaggacgaggaacacaagaag
aaagtcgaatcgaaaaacaccttggagaactacgcatacaacatgaggaacaccatcaga
gatgagaagataggcggtaaacttgccccagcagataagaagaagattgaagatgcagtt
gaacaggctattcagtggctggacagcaaccagcttgccgagtcggatgaatttgaagac
aagatgaaggaacttgagtcactctgcaaccccatcatagcaaagatgtatcaaggtgct
ggtggcgacatgggcggcgcaatggatgatgatgctcctccttctggcggcagtggcgct
ggtcctaaaattgaagaagttgattaa

DBGET integrated database retrieval system