KEGG   Momordica charantia (bitter melon): 111008209Help
Entry
111008209         CDS       T05045                                 

Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit C
  KO
K03252  translation initiation factor 3 subunit C
Organism
mcha  Momordica charantia (bitter melon)
Pathway
mcha03013  RNA transport
Brite
KEGG Orthology (KO) [BR:mcha00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    111008209
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:mcha03012]
    111008209
Translation factors [BR:mcha03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    111008209
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF-3c_N PCI DUF3175
Motif
Other DBs
NCBI-GeneID: 111008209
NCBI-ProteinID: XP_022136531
Position
Unknown
AA seq 939 aa AA seqDB search
MASRFWTQGGSGSDTEADESEYDEEIDDTIDKNQTNRSRYLEENASDSDDSGDQKRIVRS
AKDKRFEEMSATVDQMKNAMKINDWVSLQESFDKINKQLEKVMRVTESEKVPPLYIKALV
MLEDFLNQAMANKEAKKKMSTSNAKALNSMKQKLKKNNKQYEELITKYRENPEIEEEKEE
EEETEEEEEDDDSEIEDPSKIMSGSEDEEEDDDDHEDDPDHGGGAWVKKMSKKDKLMDKQ
FMKDPSXITWDTVNKKFKEVVAARGRKGTGRFEQVEQLTFLTKVAKTPAQKLEILFSVIS
AQFDVNPGLSGHMPINVWKKCVQNMLSIIDILVQNSNIMVDDMVEPDENESQKPXDYKGT
IRVWGNLVAFVERIDTEFFKSLQCIDPHTREYVERLRDEPMFMVLAQNVQEYLERVGDYK
AASKVALRRVELIYYKPQGVYDAMRKLAELSEDGDGGDASEEAKVVXESRGPAAFIVTPE
IVPRKPTFPESSRGFMDILVTLIYQYGDERTKARAMLCDIYHHALLDEFYISRDLLLMSH
LQDSIQHLDISTQILFNRAMAQLGLCGFRVGLINEGHGCLSELYSGGRVKELLAQGVSQS
RYHEKTPEQERLERRRQMPYHMHINLELLEAVHLICAMLLEVPNMAGNVHDAKRKVISKN
FRRLLEVSERQTFTGPPENVRDHVMAATRALRKGDFQKAFDVIASLDVWKLLRNRDEVLE
MVKGKIKEEALRTYLLTYSSSYDSLSSDHLTRMFDLAEGQTHSIVSKMMINEELHASWDQ
PSGCVIFHDVKHTRLQGLAFQLADKLSILAETNERAVEARIGGGGLDLPMRRRDNQEYAS
GAGGGGSRWPDNTYNHGRQGGGSSRAGYSSGGRGQGGVGGYSRDHRTGQSRGGNAGYQST
RYQDAAYGSGRTAYQSGSVRGSQMDASARMVSLNKGVHA
NT seq 2820 nt NT seq  +upstreamnt  +downstreamnt
atggcttctcgtttctggacccagggtggcagtggtagtgatactgaagcggatgagagt
gaatatgatgaggagattgatgacacaattgataaaaaccaaactaatagaagcagatac
ctggaagagaatgccagtgacagtgatgattctggcgaccaaaagcgtattgtcaggtcg
gctaaagacaagcgttttgaggagatgtctgctactgtggatcagatgaaaaatgcaatg
aagatcaatgactgggttagcctgcaggagagttttgataagataaataagcagcttgag
aaagtcatgcgtgtcaccgagtctgagaaggttccacctctttatatcaaagcacttgtg
atgctagaggacttcctaaatcaagccatggctaataaggaagctaagaagaaaatgagt
actagcaatgctaaggccttgaattcaatgaaacagaagctgaagaagaacaataagcaa
tatgaagagttaattactaagtatagggagaatcctgagattgaggaagaaaaagaggag
gaggaggagacagaggaggaggaggaggatgatgattctgaaattgaggatccttctaaa
atcatgtcaggttcagaagatgaagaagaagatgacgacgatcatgaggatgacccggat
catggtggtggtgcatgggtgaaaaagatgagcaaaaaagataagctcatggataagcag
tttatgaaggatcctagtgrgatcacatgggatactgtcaacaagaaatttaaagaggtt
gtagctgctcgcggtaggaagggaactggaagatttgagcaggttgagcagcttaccttc
ttaacaaaagttgctaagacccctgcacagaagcttgagattttgttcagtgttatatct
gcccaatttgatgtaaatcctggtctcagtgggcacatgcctatcaatgtgtggaagaag
tgtgtgcaaaatatgctttctataatcgacattcttgtacagaattctaacatcatggtg
gatgatatggttgaacctgatgaaaatgagagccagaagccagyggactataagggcaca
attcgtgtttggggaaacttggttgcttttgttgagaggatagacactgagttttttaag
agtttgcagtgtattgatccacatacacgtgagtatgttgaaagacttagagatgagcca
atgtttatggttctcgcccaaaatgttcaagaatatttggaacgagttggggattacaaa
gcagcttcaaaagttgccttaaggcgtgttgaattaatctattacaaaccacaaggggtc
tatgatgccatgagaaagcttgcagagctgtcagaagatggagatggtggagatgcaagt
gaggaggctaaagtagtagragagagtaggggccctgcggcatttattgttactccggag
atcgtacctcgcaaacccacctttccagagagtagtagggggtttatggacattctggtg
accctcatataccaatatggagatgagcggactaaagcacgagctatgctctgtgatatc
tatcaccatgctctcttggatgaattttatatttctcgcgacttgttactgatgagtcat
ttacaagatagtattcaacacttggacatttcaacacagatccttttcaacagggcaatg
gctcaacttggtctatgtggatttcgggttggcttgataaatgaagggcatggctgcctt
tcagaattatattctggtggaagggtgaaggaattgcttgcacaaggagtctcacaaagc
cgatatcacgaaaagactccagaacaggaaaggcttgaaagaagaaggcagatgccttac
cacatgcacataaatcttgagctcctggaggctgtgcatttaatatgtgctatgctgctg
gaagttcccaacatggcaggcaatgttcatgatgcaaagcgcaaggttattagtaagaac
tttagacggttactcgaggtgagtgagagacaaacgttcactggtcctcctgagaatgtc
agagatcatgtaatggctgctacccgagcccttcgcaagggtgatttccagaaggctttc
gatgtcattgcatcactagatgtatggaaactacttagaaatcgtgatgaagtgctggaa
atggttaaaggaaagatcaaggaagaggctttgaggacttaccttctcacatactcttct
tcttacgattctctgagttcagaccatctcacccgaatgtttgaccttgcagagggtcaa
acacacagtattgttagcaagatgatgatcaatgaggagcttcatgcaagttgggatcag
cctagtgggtgtgttatcttccacgacgttaagcacacccggttacagggcctggcattc
cagttggcagataagctgtcaatccttgctgaaactaatgagagggcagtggaggcgaga
attggaggaggaggattagatttacccatgaggagaagagacaaccaagaatatgcttct
ggagctggaggcgggggtagcaggtggccggacaacacttataatcatggcaggcaaggt
ggtggtagttcgcgggcaggatatagcagcggagggcgaggccaaggcggggttggtgga
tattctagagaccaccggacagggcagtcacgaggaggcaatgcagggtaccagagcacc
cgttaccaagatgccgcatatggatcggggaggactgcttatcagtctggttctgttaga
ggatcccagatggatgcttcagctcgtatggtcagcctcaacaaaggggttcatgcttaa

DBGET integrated database retrieval system