KEGG   Momordica charantia (bitter melon): 111012274Help
Entry
111012274         CDS       T05045                                 

Definition
(RefSeq) internal alternative NAD(P)H-ubiquinone oxidoreductase A2, mitochondrial-like
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
mcha  Momordica charantia (bitter melon)
Brite
KEGG Orthology (KO) [BR:mcha00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    111012274
Enzymes [BR:mcha01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     111012274
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox
Motif
Other DBs
NCBI-GeneID: 111012274
NCBI-ProteinID: XP_022142051
Position
Unknown
AA seq 547 aa AA seqDB search
MVFARIASKGLRMSGTTFGMQSCLKDTYCPGASTYKCFIQPLNNVTRNGNMLNLPHMARV
NHMEFWNRGIRTTPQHQFPSAERVVEESDLECDEPTFWPGLEATKPGEKPRVVVLGTGWA
ACRFLKGLDTKVYDVVCISPRNHMVFTPLLASTCVGTLEFRSVAEPVSMMQTALARDPNS
YFYLASCRGIDTNKHEVFCETVSKGGLPQEPYQFRVAYDKLVIAAGAEPLTFGIKGVKEH
AFFLREVNHAQEIRKKLLLNLMLSENPGISEEEKKRLLHCVVIGGGPTGVEFSGELSDFI
MRDVRDRHTHVKDDIKVTLIEANEILSSFDVGLREYATKHLTKCGVRLMRGVVKEVHSKK
IVLSDGTDVPYGLLVWSTGVGPSEFVKSLHLPKAPGGRIGVDGWLRVPSVEDVFALGDCA
GFLEQTGRPVLPALAQVAEREGKYLVELFNRIGKQNGGKASSAKDIPLGNPFEYKHLGSM
ASVGRYKALVDLRQSKDAKGISMAGFVSWFIWRSAYLTRVISWRNRFYVAVNWATTLVFG
RDNSRIG
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggtttttgcaaggattgccagtaaaggactgagaatgtccggaaccacgttcggtatg
caatcgtgtctcaaggatacgtattgccccggagcatcaacgtataaatgtttcatccaa
ccattaaataatgtcactagaaatggcaatatgttgaaccttcctcacatggcaagggtg
aatcacatggaattttggaacaggggaataagaacaacgccgcagcaccagtttccttca
gccgaaagggttgtagaggagtctgatttggagtgtgatgagccaactttttggcctgga
ctggaagcaaccaagccaggggaaaagccgagggtggtcgtcctcggtactggctgggct
gcgtgtcgattcctcaaggggctcgacaccaaggtctatgatgttgtttgcatatcacct
aggaatcatatggtgtttactcctcttcttgcttcaacttgtgttggaaccttggaattt
cggtcggtagccgagcctgtcagcatgatgcaaacggctttagcaagggatcccaattct
tacttttatctggcttcttgcaggggcattgatacaaacaagcacgaggtgttctgtgag
actgttagtaagggtggactacctcaggagccttaccaatttagagttgcttatgataag
cttgtgattgctgctggagctgagcccttgacttttggtatcaagggagtgaaggaacac
gcctttttcctccgcgaagtaaatcatgctcaagaaataaggaaaaagcttcttttgaat
ctaatgctctctgaaaatccaggtatatcagaggaagagaagaagcgtcttcttcactgt
gtcgttatcgggggtggtccaacaggtgtcgagtttagtggtgaattgagcgacttcatc
atgagggacgttcgagatcgccatactcatgtcaaagacgacattaaagttacactaatt
gaggcaaatgagattctatcgtctttcgatgtcgggctacgggaatatgcaacaaagcac
ctgaccaagtgtggtgttcgcttaatgcggggtgtcgtaaaggaagtacattccaagaag
atagttctcagtgatgggactgatgttccatatggcctcttggtctggtctacgggcgtc
ggtccctctgaattcgtgaaatcacttcatcttccaaaggcccctggtggaaggattggc
gtggatggatggctgcgagttccttccgtggaagatgtttttgcacttggggattgcgct
ggctttcttgaacaaacaggaagaccagttcttcctgctctagcccaggttgcagaaagg
gaagggaagtatctagtagagctgttcaacagaattggaaaacagaatggaggcaaggcc
tcgagtgcaaaggacattcctttgggcaacccttttgaatataaacatctgggaagcatg
gcatctgtcggccgttacaaagctctcgtcgatctacgccagtcaaaggatgcgaaaggc
atatcaatggcagggttcgtcagctggttcatatggcgatctgcttatctcactcgtgta
atcagctggagaaacaggttctatgtggctgtgaactgggctaccactcttgtctttggc
agagacaactctcggattggttaa

DBGET integrated database retrieval system