KEGG   Momordica charantia (bitter melon): 111012464Help
Entry
111012464         CDS       T05045                                 

Definition
(RefSeq) phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
mcha  Momordica charantia (bitter melon)
Pathway
mcha00010  Glycolysis / Gluconeogenesis
mcha00020  Citrate cycle (TCA cycle)
mcha00620  Pyruvate metabolism
mcha00710  Carbon fixation in photosynthetic organisms
mcha01100  Metabolic pathways
mcha01110  Biosynthesis of secondary metabolites
mcha01200  Carbon metabolism
Module
mcha_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
mcha_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
Brite
KEGG Orthology (KO) [BR:mcha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111012464
   00020 Citrate cycle (TCA cycle)
    111012464
   00620 Pyruvate metabolism
    111012464
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    111012464
Enzymes [BR:mcha01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     111012464
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPCK_ATP AAA_33
Motif
Other DBs
NCBI-GeneID: 111012464
NCBI-ProteinID: XP_022142325
Position
Unknown
AA seq 677 aa AA seqDB search
MCDIADTRMENEGKENGEFSFASGGGDTGRRGLPKIHTERITVATERDICHDDSTTPVRA
RTIDQLHSLQKKQSTPTTPMTDAHGAFSPVSDAERQKQQLKSISASLASLTRETGPKVVR
GDPEKKAEAHKATVLDHHYFDEPILNLSDSALKFTHILYNLSPAELYEQAIKYEKGSFIT
ATGALATLSGAKTGRSPRDKRVVKDETTQNELWWGKGSPNIEMDEHTFLINRERAVDYLN
SLDKVFVNDQFLNWDPEHRIKVRIVSARAYHSLFMHNMCIRPTAEELEDFGTPDFTIYNA
GQFPCNRYTHYMTSSTSIDMNLARKEMVILGTQYAGEMKKGLFSLMHYLMPKRQILSLHS
GCNMGKDGDVALFFGLSGTGKTTLSTDHNRYLIGDDEHCWSDNGVSNIEGGCYAKCIDLS
REKEPDIWNAIKFGTVLENVVFDEHTREVDYSEKSVTENTRAAYPIEYIPNAKIPCVGPH
PKNVILLACDAFGVLPPVSKLSLPQTMYHFISGYTALVAGTEDGVKEPQATFSACFGAAF
IMLHPSKYAAMLAEKMKKHGATGWLVNTGWSGGRYGSGNRIKLAYTRKIIDAIHSGSLLE
ANYTKTQVFGLEIPDAIEGVPSEILDPINTWSDKDAYKETLLKLGALFTKNYEGMHTYQL
ERDSKLAEEILAAGPIL
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgatatagcggatacgagaatggaaaacgaggggaaagagaacggcgaattcagc
ttcgcgagcggcggaggagatactggaaggagaggactcccgaagatccacacggagaga
atcacggtggcgacggagagagatatatgccacgacgatagcacgacgccggtgagagct
cggaccatcgatcagcttcactctcttcagaaaaagcaatcgacgccaacaactccgatg
accgacgctcacggcgccttttcccctgtttccgacgccgaacgccagaagcagcagctc
aaatccatcagtgcgtcgctggcgtcgctgacgagggaaactgggccgaaggtggtgaga
ggcgatccagagaaaaaggccgaggcccacaaagcgacggtactggaccatcactatttc
gacgagcccattctgaatttgagcgacagtgctctcaagttcacccacatcctctacaat
ctctcccccgccgagctttacgagcaagcgatcaagtacgagaaagggtcattcataacg
gcgacgggggctcttgccacgctttctggagccaaaacgggaaggtccccaagagacaaa
cgagtggtcaaagatgagaccactcaaaacgagctttggtggggaaaggggtcgcccaat
attgagatggatgaacacaccttcttaatcaatagagagagagccgtggattatttgaac
tcgctggataaggtatttgtgaatgatcagtttttgaactgggaccctgaacacagaatc
aaagtccgtatcgtctctgcccgagcttatcattccctgttcatgcacaatatgtgcatt
agaccaactgctgaagagcttgaggactttggcactccagatttcacaatatacaatgct
gggcagtttccatgtaatcgctacacccattatatgacttcttccaccagcatagatatg
aatcttgctaggaaggaaatggttattcttggtactcaatatgctggggagatgaaaaag
ggcctcttcagtttaatgcattatctcatgccaaagcgccagatcctctctcttcactct
ggctgcaacatgggcaaagatggagatgtggcccttttctttggattgtcaggtactgga
aaaaccacgttgtctaccgatcataataggtacttaattggagatgatgaacattgctgg
agtgataatggcgtctcgaacattgaaggcggttgttatgccaaatgtatcgacttgtcg
agggaaaaggagcctgatatttggaatgctatcaagtttgggactgtacttgagaatgtg
gtgtttgatgagcacaccagagaagtcgattactcggagaaatctgttacagagaacact
cgtgctgcatatcccatagaatacatacctaatgctaaaattccatgcgtcggccctcat
ccaaagaatgtaattcttctggcttgtgatgcatttggggttctcccaccagtgagcaag
ctgagcttgccccagaccatgtaccattttatcagtggctacactgctttggtggctgga
actgaggatggtgtgaaagagccacaggcaacattctcagcttgttttggagcagcattt
ataatgctgcacccgtccaagtatgcagccatgctagctgagaagatgaaaaaacacggc
gccacgggatggctcgtgaacactggttggtcgggagggagatatgggagtggtaaccgg
atcaagttagcctacacgaggaagataatcgacgcgatccactcgggatcccttttggag
gcaaactacaccaagactcaagtgtttgggcttgagattcctgatgccattgagggagtt
ccttcagaaatcctggatccaataaacacttggtcggacaaagacgcgtacaaggagacg
ctactgaagctgggggctctgttcacaaagaactacgaagggatgcatacttaccagttg
gagagggacagtaaactagctgaggaaattctcgcagctggtcccattttgtaa

DBGET integrated database retrieval system