KEGG   Momordica charantia (bitter melon): 111013022Help
Entry
111013022         CDS       T05045                                 

Definition
(RefSeq) protein HASTY 1
  KO
K14289  exportin-5
Organism
mcha  Momordica charantia (bitter melon)
Pathway
mcha03013  RNA transport
Brite
KEGG Orthology (KO) [BR:mcha00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    111013022
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mcha03016]
    111013022
   03036 Chromosome and associated proteins [BR:mcha03036]
    111013022
Transfer RNA biogenesis [BR:mcha03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    111013022
Chromosome and associated proteins [BR:mcha03036]
 Eukaryotic type
  Gene silencing
   microRNA pathway
    Other miRNA pathway proteins
     111013022
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Xpo1 CbtA_toxin
Motif
Other DBs
NCBI-GeneID: 111013022
NCBI-ProteinID: XP_022143035
Position
Unknown
AA seq 1194 aa AA seqDB search
MGDDTANNVAQAIAVSLDWSSTAGARNAALCYLESIKTGDVRVLASTYLILVKNKWSSEI
RLHAYKMLQHLVRLRWEEFNSMEKKNFATVCTDLIAEIANPSEEWALRSQTAALVAEIVR
REGLNLWQDLLPSLVSLSCKGPIQAELVAMMLRWLPEDITVHNEDLEGDRRRILLRGLTQ
SLPEIFPLLYTLLERHFGAALSEASSQRLDVAKQHAAAVIAALNAVNAYAEWAPLPDLAK
YGIIRGCGFLLCSPDFRLHACEFFKLVSVRKRPTDATISEYDSAMINIFEILMNISREFL
IGPSSGLIDESESEFRECICESLVSMGSSNLQCIARDSTLLPLYFQQMLGFFQHYKLALH
FQSLHFWLALMRDFISKLKVTTNSSGDFSKPSYTGSSSALSFVTDDMCTVILDISFKRLL
KKEKVSPAAAPLLGGLELWNDDFDGKGDFSQYRAKLLDLIRLFASYKPVIVSAKVSERII
TIINSLSVLQMPLQDIAVMDSMQLALENVVSTTFDGSNEFGAGSSEIQLQLREIFDGLTQ
KLLSLKWNEPALVVVLGHYLDALGPFLKYFPDAVSSVINKLFELLTSLPFAVKDPSTSSA
RHARLQICSSFIRIAKAADRSILPHMKGIADSMAYLQREGRLLRGEHNLLREAFLVMAST
AGTQQQHEILAWLLEPLSQQWIQPEWQNNYLSEPLGLVRLCSETSTMWSIFHTVTFFERA
LKRSGTRKSSSNVQNHSTTSSPHPMASHLSWMLPPLLKLLRALHSLWCPAVSQTLPGEVN
SAMTLSDTEKSSLLGEANTKLSKGPLSFTDDPHSDMNKGGGNAEPSETDIRNWFKCIRDS
GYNILGLSATVGDSFFSCLDIHSVSLALMENVHSMEFRHLRQLVHAVIIPLVKVCPPHLW
DVWLEKLLMPLIQHTQQCLNSSWSSLLHEGRANIPDVLGICSETDLKVEVMEEKLLRDLT
REVCSLLAIMASSPLNPDLPSLEQSGHVNRVAISSPKHLDAFSSSCMVGFLLKHKGLAIS
ALRICLDAFTWTDGEAVTKISSFCSTLVLLAISTKDGELHEFVSRDLFSAIIQGLTLESN
AFISSDLVGLCREIFLYLSDRNPAPRQILLSLPNIKHDDLVAFEEALAKTSSPKEQKQHM
KSLLVLATGNQLKALAAQKSVNTITNVSVKSRGSVSTSETRLDEGDSLGLAAIL
NT seq 3585 nt NT seq  +upstreamnt  +downstreamnt
atgggtgacgatacggccaataacgtggcccaagccatagccgtatctcttgactggagc
tccaccgctggcgcacggaatgctgctctctgctatctagaatctattaaaactggcgac
gtacgggttttagccagcacatacctcattctagttaaaaataagtggtcttctgaaatt
cggcttcatgcatataaaatgctacaacatttggttcgtttacgatgggaggaattcaat
tctatggagaagaaaaattttgctactgtttgcactgatttgatagctgaaattgcgaat
ccttctgaagaatgggctttaagaagtcagacagctgctcttgttgctgagattgtcaga
agagagggattaaatctttggcaagatttgctcccatctttggtttccctgtcttgtaag
ggtcctatacaagctgagttggttgcaatgatgttgaggtggcttcctgaagatattaca
gttcataatgaagatttagaaggtgatcggcgtagaatcttgttgcgtgggcttactcaa
tctttgcctgaaatttttcctctgttgtacacattactggagaggcactttggagctgca
ctgagtgaagcaagcagtcaaaggttggacgtcgcaaaacagcatgcagctgcagttatc
gctgccttaaatgctgttaatgcatatgctgaatgggctccattacctgatcttgctaaa
tatggtataatacgtgggtgtggcttcttactttgttctcctgattttcgtcttcatgcc
tgtgaatttttcaagcttgtctctgtaaggaagagaccaacagatgctaccatatctgaa
tatgactctgccatgataaatatctttgagatcttgatgaatatctctagagaatttttg
atcggccctagttctggtctgattgatgaaagtgaatctgagtttagggaatgtatttgt
gaaagtcttgtatccatgggttcatctaatttgcaatgtatagctagggacagcactctg
cttccactttattttcaacagatgctgggcttttttcaacattataaattagctcttcat
tttcaatccctgcacttttggctggcattgatgagggatttcatatcaaagctgaaggtt
acaactaattcgtcaggagatttttcaaaacctagttatacaggctctagttctgcgttg
agttttgtgaccgacgatatgtgtactgtaattcttgatatatctttcaagcggctgctc
aagaaagaaaaggtttcccctgcagcagcacccttactagggggattggagctgtggaat
gatgattttgatggaaagggtgatttcagccaatatcgggcaaagctgttggacttgatc
aggctttttgcttcatacaagcctgttatagttagtgctaaggtttccgaaagaattatc
acaatcatcaacagtctttcagttttacaaatgcctcttcaggacatagccgtgatggac
agcatgcaattagctcttgaaaatgttgtgagtactacttttgatggttcaaatgaattt
ggtgcgggcagttctgaaattcaattgcaattgcgtgaaattttcgatggcttaactcag
aaacttctttcattaaaatggaatgagccagccttggtggtagtccttgggcactatcta
gatgctttgggtccctttctgaaatattttcctgacgcagtttcaagtgtcatcaataag
ttatttgagctcctaacctcactcccctttgctgtcaaggatccttctacaagtagtgca
cgacatgctaggctacagatttgttcatcctttattcgtatagcaaaagctgctgataga
agtattctgccccatatgaagggaatagctgactccatggcatatttacaaagagaagga
cgtttgcttcgtggtgagcataatcttctgcgtgaagcattccttgttatggcctctact
gctggaacccaacagcagcatgaaattttagcatggttgctggaacctttgagccaacag
tggattcagcctgagtggcaaaataattatttgtctgagccactgggtttggttcgtctt
tgttctgagacatcaacaatgtggtcaattttccacactgtgacattctttgaaagagca
cttaagagaagtgggacgagaaaatccagttcaaatgtgcagaaccactcaaccacaagt
tctcctcacccaatggcttctcatttgtcatggatgctccctcccctgttaaaattgctc
cgcgctctacattctctttggtgtccagctgtatcccagacattgcctggagaggtcaat
tctgcaatgactttgagtgatactgaaaaatctagtcttctcggtgaagcgaacacaaaa
ctttctaaaggtccattaagtttcacagatgatcctcattctgacatgaacaagggagga
gggaatgcagaacctagtgaaactgatattcggaactggtttaagtgtataagagacagt
gggtacaacatcctgggtttatcggcaactgttggagattcatttttcagttgcttggat
attcattctgtctctcttgccctgatggagaatgtccactcaatggaatttagacattta
aggcagctagttcatgcagttattattcctctggttaaggtttgtcctccacatttgtgg
gatgtctggctggagaagctcctgatgccattaattcaacatacccagcaatgtcttaac
tcctcatggtccagtctcctacatgaaggtagagcaaacatccctgatgtccttggaatc
tgttcggaaacggacttgaaagtggaagttatggaagaaaagctacttcgagatttaacc
cgagaagtctgttcgcttcttgccattatggcttcatctccacttaatcccgaccttcct
tccctggagcaatctggacatgtcaatcgtgtggctatatcatctcccaaacacttggat
gcgttctcatcaagctgcatggttggtttcttattaaagcacaaaggcttagccatttcg
gcactacggatatgcttggatgcatttacatggacggatggggaagccgtgacaaaaatt
tcttccttctgctctactttagttcttttagctatttcaacaaaagatggggagcttcat
gagtttgtttctcgcgatctgttctcagcaattattcaaggactaactcttgagtccaat
gctttcattagttctgatctggttggtctctgtcgtgaaatatttctatacctctctgac
agaaacccagctcctagacagatcttgctctcgctccccaacattaaacatgatgatttg
gtagcttttgaagaagctttggcaaagacatctagtccaaaagaacaaaagcagcatatg
aagagtttgcttgtattagcaactggaaaccagttaaaggctctagcagcccagaaaagt
gtaaataccattactaatgtatcagtcaagtcccgcggttcagtcagtacttcagaaacc
agattggatgaaggggattctcttggtctggcagcaattttgtga

DBGET integrated database retrieval system