KEGG   Momordica charantia (bitter melon): 111013817Help
Entry
111013817         CDS       T05045                                 

Definition
(RefSeq) pyruvate decarboxylase 2-like
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
mcha  Momordica charantia (bitter melon)
Pathway
mcha00010  Glycolysis / Gluconeogenesis
mcha01100  Metabolic pathways
mcha01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mcha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111013817
Enzymes [BR:mcha01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     111013817
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_M TPP_enzyme_C TPP_enzyme_N
Motif
Other DBs
NCBI-GeneID: 111013817
NCBI-ProteinID: XP_022144025
Position
Unknown
AA seq 486 aa AA seqDB search
INAVAGAFSEDLPVVCIVGGPNSNDYGSKKILHHTIGLPDFSQELRCFQNVTCYQAVIDS
LKDAQWKIDTAICKCLEESKPIYISVCCNLVATPHPSFSIQSLIPLSLPPKQSNQMGLEA
AVEKAAQLLNSAVKPVAVAGKKLRLAKAQAAFVELADACGYAVAVTPSAKGLFPENHPHF
IGTYWGVLSTAFCGETVEIADASLFAGPTFDELETVGFSLCYKKNNAIIVEPERVVFPNG
PSFGPILMMDFLRALTKRLKPNPTAYENYRRIYVPESGPLQSEPGEALRVNVLFKHIQKM
LSSNMAVISEAGDSWFHCQKLKLPQSCGYEMQIIYASIGWSLGATLGYAQAASNERMVLC
MGDGSFQMAPQDLSTMLRLGQRNIIFLINNGGYTIEVEIHDGPYNVIKNWDYTALVDAMH
NANGNCWTTKVKTEEELVKAIQIAMGEKNDCLCFIETIVHRDDTSKELLEFGNKLAAINS
RPPKPL
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atcaacgccgtggccggagctttctcggaggatcttccggtggtgtgcattgtgggtggg
cccaattccaatgattatgggagtaaaaagattctccaccataccattgggctgcctgat
ttctcccaagaacttcgttgctttcaaaatgttacttgttatcaggctgtaattgacagt
ctgaaagacgcacaatggaagatagacacagcaatttgcaagtgtttggaagagagcaag
ccaatttacattagcgtttgctgcaatttggtggccactcctcatccttctttctcgatc
caatccctcatcccactttccctccctcccaagcaaagtaaccagatgggtctggaggcg
gcggtggagaaggcagctcagcttctaaatagcgccgtgaaaccagtggccgtcgccgga
aagaagctgcgcctcgccaaagcccaggcggcgttcgtggagctggccgacgcttgtggc
tacgccgtcgccgtcacgccgtcggcgaaaggcctgttcccggagaaccaccctcatttc
atcggcacttactggggagttctcagcaccgccttctgcggtgagaccgttgagatcgcc
gacgcctcgctcttcgccgggcccactttcgacgaacttgaaaccgtcggattctctctt
tgctacaaaaagaacaacgcgattatcgtggagccggagcgcgtcgtgtttcctaatggg
ccgagttttgggcccattttaatgatggacttccttcgggccctaactaagcgcctcaag
cccaatccaacggcctacgagaattaccgccggatttatgttccggagtcgggtccactc
cagtcggagccgggcgaggccttgcgggtcaatgttcttttcaaacatattcagaaaatg
ttgtcgagtaacatggctgtgatttctgaggccggtgactcttggtttcactgtcaaaaa
ttgaaactaccacaatcgtgcgggtatgagatgcagataatctatgcatccattggatgg
tctttaggggcaactctcggatatgcacaagctgcatcaaacgaacgaatggttctctgt
atgggtgatgggagctttcagatggctccacaagatttatcgacgatgttaaggttggga
caaaggaacataatatttttgataaataatggtggatacaccattgaagtagaaattcac
gatggaccttacaatgtcatcaagaattgggactataccgccctcgttgatgccatgcat
aatgctaatggtaattgttggaccaccaaggttaaaacagaagaagaattggtgaaagca
atccaaatagcaatgggagaaaaaaatgattgcttgtgtttcatagagactattgtccat
cgagatgatacaagtaaagagttgcttgaatttgggaacaagcttgctgccattaatagt
cgtcctcctaaacctttataa

DBGET integrated database retrieval system