KEGG   Momordica charantia (bitter melon): 111014319Help
Entry
111014319         CDS       T05045                                 

Definition
(RefSeq) glucomannan 4-beta-mannosyltransferase 9-like
  KO
K13680  beta-mannan synthase [EC:2.4.1.32]
Organism
mcha  Momordica charantia (bitter melon)
Brite
KEGG Orthology (KO) [BR:mcha00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mcha01003]
    111014319
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mcha02000]
    111014319
Enzymes [BR:mcha01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.32  glucomannan 4-beta-mannosyltransferase
     111014319
Glycosyltransferases [BR:mcha01003]
 Polysaccharide
  Structural polysaccharide
   111014319
Transporters [BR:mcha02000]
 Other transporters
  Others
   111014319
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_tranf_2_3 Glyco_trans_2_3 Glycos_transf_2 Glyco_transf_21
Motif
Other DBs
NCBI-GeneID: 111014319
NCBI-ProteinID: XP_022144694
Position
Unknown
AA seq 530 aa AA seqDB search
MDQLSAAVALLPGNGISTVELYMAWEAIRAPLIAPLLRFLIVICTTLSIVQFVERIYMGV
VIILVKLLGRTPEKRFKWEAMKDDSELGSSAYPMVLVQIPMFNEKEVYQWSIRATCGLSW
PADRIIIQVLDDSTDPVIKEMVEMECRKWANKGINIKYEVRDNRTGYKAGALKEGMKRSY
AQECDYVVIFDADFQPESDFLQRSIPYLVHNPELALIQARWIFVNSNECMMTRLQEMSLD
YHFTVEQEVGSSTYSFFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLKGWKFL
YLGDLQVKNELPSTFKAFRFQQHRWSCGPANLFRKMVLEIARNKRVTLWKKVYVIYSFFF
VRKIIAHINTFLFFCVVLPATVMVPEVSIPKWGAVYIPTATTIINAIGTPKSFHLTVFWI
MFENVMSLHRAKATLIGLLEGSRANEWVVTEKLGDILKGKAASKAPKKPRLSVIGERIHI
WELGIGAYLFFCGYYDLFYGKNHFFIFLFVQSLSFFIVGFGYVGTIVPSS
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggatcagctctcggctgcggtggcccttcttcccggaaatggcatttctacggtggag
ctctatatggcctgggaggccatcagagcaccattgatcgctcccctgcttcgcttcctg
attgtgatctgtacgacattgtcgatagtgcagttcgttgagaggatctacatgggcgtg
gtgatcattctagtgaagctactcggccggacgccggagaagcgcttcaaatgggaagcg
atgaaagacgactccgagcttggaagctcggcttatcccatggtccttgttcaaatccca
atgtttaacgaaaaagaggtctatcaatggtcgattagagcaacttgtgggctttcatgg
ccggccgatcggatcatcatacaagtgctggatgattcaacagatccagtgatcaaggaa
atggtggagatggagtgcagaaaatgggcaaacaaagggattaacataaagtacgaagtg
agagacaaccggacaggatacaaagccggtgctctgaaagaaggcatgaaacggagctat
gcccaagagtgcgattacgtcgtcatcttcgatgccgactttcaaccagaatctgatttt
cttcagcgatctattccttaccttgtccataacccagaactcgccctcattcaagcccgc
tggatttttgtgaactccaacgaatgcatgatgacaagactacaagagatgtcattggac
taccatttcacagtggagcaagaagtcgggtcctcgacctattccttcttcgggttcaat
ggtacggcaggtgtttggagaattgcggcaatcaacgaggccggggggtggaaggatcgc
accacggtggaggacatggatttggccgtgcgagccagtctcaagggctggaaattctta
taccttggcgatcttcaggttaaaaatgaattgccaagcactttcaaggccttccgtttt
cagcagcacaggtggtcgtgtggccctgcaaatcttttcaggaaaatggtcttggagatt
gcaagaaataagagagtgacattatggaagaaggtgtatgtgatatatagcttcttcttc
gttaggaagatcatagcccatatcaacacctttcttttcttctgtgttgttctgcccgca
actgttatggtgcctgaagtttcgattccaaaatggggggctgtgtatattcctacggca
actaccattattaatgccatcggaacgccaaagtcattccacttgacggttttctggatc
atgttcgaaaatgttatgtccttacacagagccaaggccaccctcatcggcctattagag
ggtagtcgagcaaatgaatgggttgtcaccgagaaattaggagatattctcaagggcaaa
gcagcctcaaaagcacccaaaaagccaaggctcagtgtaattggagagagaattcatatt
tgggagcttgggattggagcctatctcttcttctgtggatactatgatttgttctatggg
aaaaaccacttcttcattttcctttttgtccaatcactttcatttttcattgtggggttt
gggtatgttggcactattgttcccagctcttag

DBGET integrated database retrieval system