KEGG   Momordica charantia (bitter melon): 111014345
Entry
111014345         CDS       T05045                                 

Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
mcha  Momordica charantia (bitter melon)
Pathway
mcha00100  Steroid biosynthesis
mcha01100  Metabolic pathways
mcha01110  Biosynthesis of secondary metabolites
Module
mcha_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:mcha00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    111014345
Enzymes [BR:mcha01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     111014345
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 111014345
NCBI-ProteinID: XP_022144726
UniProt: A0A6J1CUA1
Position
Unknown
AA seq 369 aa
MDLGFLLQASIPSWEAVAILLIFFSYLAIAGSILPGRIIPGVILPDRTRLQYRCNGLLSL
LVLVALLGIGVQTNYISPTAISDRGLELLSATFWFSFLATLLLCVAGYSSSSESSSLKPR
ITGNLIHDWWFGIQLNPHFLGIDLKFFFVRAGMMGWLLINLSVLARSVLNTTLSQSMILY
QTFCALYVLDYFVHEEYMTSTWDIIAERLGFMLVFGDLVWIPFTFSIQGWWLLTNKAELT
TAATIANCLVFIMGYAVFRGSNKQKHMFKKNNKALIWGRPPKVVGGKLLVSGYWGIARHC
NYLGDLLLALSFSLPCGISSPMPYFYPMYLLILLIWRERRDEARCAEKYKDVWAEYTKLV
PWRILPYVY
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggatctgggttttcttcttcaagcatcaattccctcttgggaagctgttgctattctc
ttgatcttcttttcttacttggcgattgctggatctattttgccgggaagaataatccct
ggagtgattttgcctgaccgcaccaggcttcaatatcgctgcaatggtctactctctctt
ttggtgctcgtcgcccttcttgggattggtgttcaaacgaattacatttctcccactgca
atatcagatagaggactggagctgctatcagcaactttctggtttagtttcctggcgaca
ttgttactctgtgttgctggatacagttcaagtagtgaaagttcttctctaaagcctcgt
atcacaggaaatcttattcatgattggtggtttggtatacagttgaatcctcactttttg
ggcattgacctcaaatttttctttgttagagctggaatgatgggctggctactgattaac
ctatcagttcttgcaagaagtgttttaaacaccaccttgagccaatccatgatcctctac
cagacattttgtgcgttatatgtcttggactatttcgttcacgaggagtacatgacctcc
acatgggacataattgctgagagattaggcttcatgctggtatttggagatcttgtttgg
attccttttacatttagtattcagggttggtggcttttgacaaacaaggcagagttaacg
acagctgctaccatagctaactgtttagtctttataatgggatatgctgtgtttagagga
tctaacaagcagaaacacatgtttaaaaagaacaacaaagcgcttatatggggtaggcct
ccgaaagttgtcggagggaagttgcttgtttctggttattggggaattgcgcggcactgt
aattaccttggagacttgttgcttgcactttctttcagcttaccatgtgggataagctcc
ccaatgccatacttttatcctatgtatctcctcattctgctaatatggagagagagacga
gacgaagctcgttgtgctgagaaatataaagacgtttgggcagagtataccaaactcgtc
ccttggagaatactgccttatgtttattag

DBGET integrated database retrieval system