KEGG   Momordica charantia (bitter melon): 111014739Help
Entry
111014739         CDS       T05045                                 

Definition
(RefSeq) probable glutathione peroxidase 2
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
mcha  Momordica charantia (bitter melon)
Pathway
mcha00480  Glutathione metabolism
mcha00590  Arachidonic acid metabolism
mcha01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcha00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    111014739
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    111014739
Enzymes [BR:mcha01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     111014739
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 111014739
NCBI-ProteinID: XP_022145238
Position
Unknown
AA seq 202 aa AA seqDB search
MHFFKIANWIALLFLCFSAFYYYQTGQISHSFLLNMAEESPKSIYDFTVKDIRGNDVCLS
QYSGKVLLIVNVASKCGFTDSNYKELNVLYDKYKSQGFEILAFPCNQFARQEPGNNEEIQ
ETLCTRFKAEFPIFDKVEVNGKNAAPIYKFLKLKKGGIFGDGIKWNFTKFLVNREGKVVD
RYAPTTPPLNIEKDIQNLLGSA
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgcatttcttcaaaattgccaattggatcgccctcttgtttctctgtttctccgcattt
tattactaccaaacaggccaaatttctcactcgtttcttctcaatatggctgaagaatcc
cccaaatccatatatgatttcactgtcaaggatattcgtgggaatgatgtgtgccttagt
caatacagtgggaaggttcttctgatagtgaatgttgcttctaagtgtggttttacggat
tcaaactacaaggaattgaatgtattgtatgacaagtacaaaagtcaaggtttcgagata
ttggcatttccttgcaatcaatttgcacgacaagagccaggaaacaatgaggagatccag
gaaactctatgcacaaggttcaaagcagaattccccatctttgataaggtcgaggttaac
ggtaagaatgcagcacccatttataaattcctgaaattgaaaaagggtggaatatttggc
gatggcatcaaatggaacttcacgaagttcttggtgaacagagaaggaaaggtcgttgac
agatatgctcctaccacccctcctctcaacattgagaaagatatccagaatctattggga
tctgcttga

DBGET integrated database retrieval system