KEGG   Momordica charantia (bitter melon): 111015108Help
Entry
111015108         CDS       T05045                                 

Definition
(RefSeq) pyruvate decarboxylase 1
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
mcha  Momordica charantia (bitter melon)
Pathway
mcha00010  Glycolysis / Gluconeogenesis
mcha01100  Metabolic pathways
mcha01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mcha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111015108
Enzymes [BR:mcha01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     111015108
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C CO_dh
Motif
Other DBs
NCBI-GeneID: 111015108
NCBI-ProteinID: XP_022145722
Position
Unknown
AA seq 606 aa AA seqDB search
MDIKIGSLDTCKPPNSAVCCPSNGSVCTIQNSVPSSAVVNSSEATLGRHLARRLVQIGVT
DVFTVPGDFNLTLLDHLIAEPGLNNIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLS
VLNAIAGAYSENLPLICVVGGPNSNDYGTNRILHHTIGLPDFSQELRCFQTVTCFQAVVN
NLEDAHELIDTAISTALKESKPVYISISCNLPGIPHPTFSRDPVPFSLSPKVSNPSGLEA
AVEAAANFLNKAVKPVLVGGPKMRVAKACGAFVELADACGYALAVMPSAKGLVPEYHPHF
IGTYWGAVSTSFCAEIVESADAYVFAGPIFNDYSSVGYSLLLKREKAIIVQPDRVTIGNG
PTFGCVLMKDFLQALAKRVKNNITAYENYHRIFVPEGQPMKSEPREALRVNVLFQHIQKM
LSNQTAVIAETGDSWFNCQKLRLPKGCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVISC
IGDGSFQVTAQDISTMIRCRQNAIIFLINNGGYTIEVEIHDGPYNVIKNWNYTALVDAIH
NGEGKCWTTKVRCEEELVEAIETATEAKKDSLCFIEVIAHKDDTSKELLEWGSRVSAANS
RPPNPQ
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atggacatcaaaatcggctccctcgacacctgcaagccccccaacagcgccgtctgctgc
ccatccaacggctctgtttgcaccatccaaaattccgtcccctcctccgccgtcgttaac
tcgtcggaggccaccctcggccgccacctcgcccgccgcctcgtccaaatcggcgtcacc
gatgtgttcaccgtccccggcgatttcaacctcacgcttctcgaccatttaatcgccgag
cccgggctgaacaacatcggctgctgtaacgagcttaatgccgggtacgccgccgacggc
tacgcgaggtcccgcggcgtcggcgcgtgcgtcgtcacgtttaccgtcggcggactcagc
gttctgaatgcgatcgccggcgcgtacagtgagaacttgccgctcatttgcgtcgtcggt
ggtcccaactccaacgattacggaaccaacagaatcctccaccacaccatcggcctccct
gacttcagccaagaacttagatgctttcaaaccgtcacttgctttcaggcggttgtgaat
aatctggaagatgcacatgagttgattgatactgccatttcaactgccctgaaagaaagc
aaacctgtttatataagcatcagttgtaacttgcctgggattccccatcccaccttcagc
cgcgatccagttccattttcactgtctcccaaagtgagcaatccatctggactagaggct
gcggtggaggcggcggcaaatttcttgaacaaagccgtgaagccagtccttgttggtggg
cctaagatgcgagttgccaaggcgtgtggcgcctttgtggagctcgctgatgcctgtggc
tacgccttggccgtgatgccatcggccaaggggctcgtccccgagtaccaccctcacttc
atcggaacttactggggcgctgtcagcacctccttctgcgctgagatcgtcgagtctgct
gatgcgtatgtgtttgcagggccaattttcaacgactacagctctgttgggtactcactg
ttgctcaaaagagagaaggcgatcatcgtgcagcccgatcgcgtgaccatcggcaatgga
ccgacatttgggtgtgttctaatgaaagatttcctccaagcacttgcaaagcgggtgaag
aacaacatcactgcctatgaaaactaccacaggatctttgttcctgaaggccaaccgatg
aaatctgagccaagagaggcattgagagtcaatgttttgttccaacacattcagaagatg
ctcagtaatcaaacggctgtgattgctgaaacaggggactcttggtttaactgccagaaa
cttagattgccaaaaggatgcggatatgagttccaaatgcagtatggttctattggttgg
tcagttggtgccactcttggatatgcacaggctgtaccagagaaaagagtaatttcttgt
attggtgatggaagctttcaggtgactgcacaagacatatcgaccatgatccgatgcagg
cagaacgccatcatattcttgataaacaatggtggttacaccattgaagtcgagatccac
gacgggccttacaatgtgataaagaactggaactacactgcgttggtcgatgcgatccac
aacggggaaggaaagtgttggacgacgaaggttcgatgcgaggaagagcttgtggaggcc
attgaaacagctacagaagccaagaaggacagcttgtgtttcattgaggtaattgctcat
aaggatgataccagcaaagagcttttggaatggggctcgagagtctctgctgccaacagc
cgtcctcccaatcctcagtaa

DBGET integrated database retrieval system