KEGG   Momordica charantia (bitter melon): 111015966Help
Entry
111015966         CDS       T05045                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1 isoform X1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
mcha  Momordica charantia (bitter melon)
Pathway
mcha00010  Glycolysis / Gluconeogenesis
mcha00562  Inositol phosphate metabolism
mcha01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111015966
   00562 Inositol phosphate metabolism
    111015966
Enzymes [BR:mcha01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     111015966
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     111015966
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 111015966
NCBI-ProteinID: XP_022146871
Position
Unknown
AA seq 496 aa AA seqDB search
MAGAKQMVMAILLLFFLFRFTNSIAEESFGVEQHLSTVTRYSASRGIRDGNYAPAPDGCV
PIHLNLVARHGTRAPTKKRIRELDNLESRLEMLIRVAVENGLSLHRVPSWMKGWKSPWKG
KVKGGELISKGEEELYDLGIRTRKMFLELFSDDYHPEVYAIKATQVPRASASAVAFGMGL
FSGRGSLGSGRHRAFSVISESRASDTMLRFFDCCQRYEDYRKNQEPAVDKLKEPVLDDIT
KSLSERYGLNFTRQHISSLWFLCKQEASLLDITDQACGLFSPSEVALLEWTDDVEVFILK
GYGNSLNYKMGVPLLEDIVQSMEQAIKAKEEKQAPGSYEKARLRFAHAETVVPFTCLLGL
FLEGSEFRQIQREEPLQLPPRPPATRIWKGGNVAPFAGNNMLVLYNCPANSSDQYFVRVL
HNEEPVPLLGCDGSDLCSFNVFKEKIVAPHLKHDFNTLCAANMEKPTSEPETSKLSLFRW
LFWPRNDDKQPRKDEL
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggcaggagcgaagcagatggttatggcgattttgcttctatttttcttgttccgattc
actaattccatagccgaagaatctttcggtgtcgagcaacatctctcgactgttaccaga
tatagtgcgtcgagaggtattcgtgatggtaactatgctcccgctcccgatggatgtgtt
cctattcatttaaatcttgtggccaggcatgggactcgtgctccaacaaaaaaacggatt
agagagttggacaacttggaaagtcgtttggagatgcttataagagttgcagtagaaaat
ggcttgtctctgcatagagttccttcttggatgaagggatggaaatctccttggaaagga
aaagtgaagggtggagaattaatttctaaaggagaggaagaattgtatgatcttggaatc
cgaacaagaaagatgtttctggaattgtttagtgatgattatcatccagaagtatatgca
attaaagcaactcaggttcctcgggcatcagctagtgctgtggcatttggcatggggctg
tttagtggtagaggaagccttggatcaggtcgtcatcgagctttttctgttatcagtgaa
agtcgtgccagtgatactatgcttaggttttttgattgttgtcaaagatatgaggattat
aggaagaatcaggaacctgccgttgacaagctcaaggaacctgtacttgatgatataact
aagtcactaagtgaacgttatggtctgaattttactcggcagcacatttcatctctttgg
tttctctgtaagcaggaggcgtccttattggacattacggatcaagcctgtggactgttt
agcccttctgaggttgctttgttggagtggacggatgatgttgaggtgtttatattgaag
ggttatggtaattcattaaactataaaatgggagttcctttgttggaagatattgtccaa
tccatggagcaagctatcaaggccaaagaagaaaaacaagctcctggcagctatgaaaag
gcaagacttcgttttgctcatgctgaaactgtggttccattcacttgtttgcttgggctc
ttccttgaaggatctgaatttagacaaatacaaagggaagagcctttgcaacttcctcca
cggcctccagcaactagaatttggaaggggggcaacgttgcaccttttgctgggaataac
atgctggttctgtataactgccccgcaaactcatcggatcagtactttgtgcgagttttg
cataatgaagaacctgtaccattgctgggttgcgacggttcggatttatgctcctttaat
gtctttaaggagaaaattgtggctcctcatcttaagcacgacttcaacacattgtgtgct
gcaaacatggaaaaaccgacatcagagcctgaaaccagtaagttatcactgttccgctgg
ctcttctggccgcgcaatgacgataaacaaccccgaaaagatgaattgtag

DBGET integrated database retrieval system