KEGG   Momordica charantia (bitter melon): 111017048Help
Entry
111017048         CDS       T05045                                 

Definition
(RefSeq) non-specific phospholipase C1
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
mcha  Momordica charantia (bitter melon)
Pathway
mcha00562  Inositol phosphate metabolism
mcha00564  Glycerophospholipid metabolism
mcha00565  Ether lipid metabolism
mcha01100  Metabolic pathways
mcha01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mcha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    111017048
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    111017048
   00565 Ether lipid metabolism
    111017048
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:mcha02042]
    111017048
Enzymes [BR:mcha01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     111017048
Bacterial toxins [BR:mcha02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   111017048
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phosphoesterase
Motif
Other DBs
NCBI-GeneID: 111017048
NCBI-ProteinID: XP_022148383
Position
Unknown
AA seq 534 aa AA seqDB search
MISRRVSVTSFFLLYLLFSSQALEFNFWKRRHEIKGPIKTVVVVVMENRSFDHVLGWLKS
IRPEIDGLTGKESNRISVSDPNSEEIFVSNDAVFVDSDPGHSFQAIREQIFGSNDSSANP
APMNGFAQQAAAMGAADMPKTVMSGFKPERVPVYTELANEFAIFDRWFASVPASTQPNRF
YVHSATSHGAMSNVRKDLIHGFPQKTIFDSLDENGLSFGIYYQNIPATLFFKSLRRLKHV
VKFHSYSPKFKLHAKLGRLPNYAVIEQRYFDVDLFPANDDHPSHDVARGQKFVKQVYETL
RASPQWKEMALLITYDEHGGFYDHVPTPVAGVPNPDGIIGPDPYYFRFDRLGVRVPTILV
SPWVEKGTVIREPVGPTPTSQFEHSSIPATVKKLFNLKSNFLTKRDAWAGTFEHYLKLRD
SPRDDCPETLPKVTAPLRPWGPKEHAELSEFEVELIQLASQLNGDHVLNSYPNIGKSMTV
GQANRYAEDAVRRFLEAGRVALMAGANESAIVTMRPSLTSRTAAADSGRFLETI
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgatttcccggagagtgagtgtgacctccttttttctcctttatctcttattctcttcc
caagctttggagttcaatttttggaagcgacgccatgaaatcaaaggacctatcaagact
gtggtggttgtggttatggagaatcgctccttcgatcacgtcttaggctggctgaaatcc
attcgacctgaaatcgatggattgacggggaaagaatcgaaccggatttctgtttctgat
ccgaactctgaagaaatcttcgtctccaacgatgcggtgttcgtcgattcggatcccggc
cattcgtttcaggcgatcagggagcaaattttcggatcgaacgacagttcggcgaatccg
gctccgatgaacggatttgcacagcaggcggcggccatgggcgcagccgacatgccgaaa
accgtaatgagcgggttcaaaccggaacgagttccggtctacaccgagctagcgaacgaa
ttcgcgatattcgaccggtggttcgcatcggttccggcgtcgactcagccgaatcgattc
tatgtccactccgctacctctcacggtgccatgagcaatgtgaggaaggacctcatccat
ggcttccctcagaaaacaattttcgactcattggacgaaaatggcctctcatttggcatt
tattaccaaaatatccccgcaaccctattcttcaaaagtttgaggaggctgaagcacgta
gtgaaatttcactcttactctccaaaattcaaattgcacgcgaagcttggaaggctccca
aattacgcggtgattgagcagcgttacttcgacgtcgatctttttccggcgaacgacgat
catccgtcgcacgacgtggcgcgcgggcagaagttcgtgaagcaggtgtatgagactctt
agggcaagtccgcagtggaaggagatggcattgctgattacctacgatgagcacggtgga
ttttacgatcacgttccgacgccggtagccggcgtccccaacccggacggcatcattgga
ccggacccgtactacttccggttcgaccggctgggcgtgcgggtgccgacgatactggtt
tcgccgtgggtcgagaagggtacagtgatccgtgagcctgttggaccaacacctacctct
caatttgaacattcttcaatcccggctactgtgaagaaacttttcaacctgaaatcaaac
ttcctcacgaagcgggatgcatgggctggtactttcgagcattatttgaagctccgcgac
agtcctcgtgatgattgtccagaaactctcccaaaggtgacagcaccgctgcggccatgg
ggaccgaaagagcacgcagaactctccgaattcgaagtcgaactgatccaacttgcatcg
cagctcaacggtgaccatgtcttgaattcttacccgaacatcggcaaatctatgactgtt
ggtcaagccaataggtatgcagaagatgcagtcagaagatttctggaagctggaagggtt
gctctcatggcaggagctaacgagtctgccattgtcaccatgaggccgtccctaaccagc
cgaactgcagctgcagactccggtcgctttctcgaaacgatatga

DBGET integrated database retrieval system