KEGG   Momordica charantia (bitter melon): 111020519Help
Entry
111020519         CDS       T05045                                 

Definition
(RefSeq) vacuolar protein sorting-associated protein 41 homolog
  KO
K20184  vacuolar protein sorting-associated protein 41
Organism
mcha  Momordica charantia (bitter melon)
Brite
KEGG Orthology (KO) [BR:mcha00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcha04131]
    111020519
Membrane trafficking [BR:mcha04131]
 Endosome - Lysosome transport
  Tethering complex
   Hops complex
    111020519
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin zf-RING_2 WD40 zf-RING_5 zf-RING_UBOX zf-C3HC4 zf-RING_11
Motif
Other DBs
NCBI-GeneID: 111020519
NCBI-ProteinID: XP_022152902
Position
Unknown
AA seq 960 aa AA seqDB search
MAPIASENGVEGDDEREEEEEDEEEEEEGAEFGGDEEEPRLKYQRMGGSVPSLLASDAAS
CLAVAERMIALGTHAGTVHILDFLGNQVKEFSAHTAVVNDLSFDIEGEYVGSCSDDGSVV
INSLFTDERMRFEYHRPMKAIALDPDYVKKTSRRFAAGGLAGHLYFNSKKWLGYKDQVLH
SGEGPIHTVKWRTSLIAWANDAGVKVYDAANDQRITFIERPRGSPRPELLLPQLVWQDDT
MLVIGWGTSVKIASIRTNQNRAANGTQSSRHVPLSSMNRVDIVASFQTSYLITGMAPFGD
FLVVLAYIPGEEGEKDFSRSAPSRQGNAQRPEVRMVTWNNDELSTDALPVHGFEHYKAKD
YSLAHAPFSGSSYAGGQWAAGDEPLYYIVSPKDVVIAKPRDAEDHIAWLLEHGWHEKALE
AVEAGQGRSELLDEVGSRYLDHLIVERKYAEAASLCPKLLRGSASAWERWVFHFAHLRQL
PVLVPYIPTENPRLRDTAYEVALVALVSNPSFHKDLLATVKSWPPVIYSALPVISAIEPQ
CNTSSMTDALKEALAELYVIDGQYEKAFLLYADLLKPDIFDFIEKYNLHETIREKVVQLM
MLDCKRAVPLFIQNKELIPPNEVISQLLKARDTCDFRYFMHLYLHSLFEANPHAGKDFHD
IQVELYADYDRKMLLPFLRSSQHYTLEKAYEICIKKNLLREQVFILGRMGNAKQVLAVII
DKLGDIEEAVEFVSMQHDDELWEELIKLCLHKAEMVGMLLEHTVGNLDPLYIVNRVPNGL
EIPRLRDRLVKIITDYRTETSLRHGCNDILKADTVNLLVKYYKEAKHGIYLSNEEDEARG
KRNENKVSQTIQKSSSVRMMEVKSKTRGGTRCCICFDPFSIQNISVIVFFCCHAYHATCL
TESTSNLDAKKGAGETRHDSTSDFDYDNGEVEDDDEDDDENDTDVGGPRMRCILCTTAAS
NT seq 2883 nt NT seq  +upstreamnt  +downstreamnt
atggctccgattgcgtcggaaaacggcgtggaaggcgatgatgagagggaggaggaggag
gaagacgaggaagaagaagaggagggagcagaattcggtggcgatgaggaggaacccagg
ctcaagtatcagagaatgggcggaagcgtgccatcgctgctggctagtgatgccgcgtcg
tgccttgccgttgctgagaggatgatcgcgcttgggactcacgccggcaccgttcatatt
ctcgactttctcggaaatcaggtcaaggaattctctgctcatactgctgtagtcaacgac
ctcagctttgatatagaaggtgaatatgtaggaagctgttcggatgatggttcagtggta
ataaatagtctattcactgatgagagaatgaggttcgagtatcatcgccctatgaaggca
attgcactggacccagactatgtaaagaaaacttctagaagatttgcagcaggtggtcta
gcgggccatttatattttaattcaaagaaatggctaggatataaagaccaggtcttgcat
tctggtgaaggtccaatacatacagtgaaatggagaacaagccttattgcttgggcaaat
gatgctggtgtaaaagtttatgatgctgcaaatgatcagcgaattacatttatagaaaga
ccgagaggaagcccacgtcctgaacttttgctccctcaattagtttggcaggatgatact
atgttggtcattggttggggaacatctgtgaagattgcatcaattcgaacaaaccagaat
agagcggccaatgggacacagagtagtaggcacgttccattgtctagcatgaaccgggtt
gatatagtggcatcttttcaaaccagctacttaatcacaggaatggctccatttggggat
ttcttggttgttctagcttatattcctggagaagaaggtgaaaaggattttagtagaagt
gctccatctcggcagggaaatgcacaaagaccagaagttcgtatggtaacatggaacaat
gatgaactatctactgatgcattacctgtacatggttttgagcattacaaggcaaaggac
tattcccttgcacatgctcctttctcaggcagcagctatgctggtggtcagtgggctgct
ggtgatgaacctctatactatattgtatcccctaaggatgtagttattgcaaagcccagg
gatgctgaagatcatattgcttggcttcttgaacacggctggcatgaaaaagctctggaa
gcagttgaagcaggtcaaggaagaagtgaactcctagacgaggttggatctagatatctt
gatcacttgattgtggaaagaaaatatgctgaagctgcttctctgtgtcccaaattgttg
cgaggctctgcttctgcttgggagagatgggttttccactttgctcatctgcgtcaactt
cctgtgttggttccatatattccgacagaaaatcctagattgcgtgatactgcttatgag
gtggctcttgttgctcttgtttcaaatccatcatttcataaggatctattagcgactgtt
aagtcttggccacctgtgatttattctgctttgcctgttatctcagccatagaacctcag
tgcaatacttcttcgatgactgatgctcttaaagaggcattagctgagttgtatgttata
gatgggcagtatgagaaagcttttctgctgtatgctgatcttctgaagccagatatattt
gactttattgagaaatacaatctgcatgagaccattcgtgaaaaggttgtccaactcatg
atgctagattgcaagcgtgccgttccattatttatccaaaacaaggaattaattcctcca
aatgaagttatttcacagcttcttaaagccagagatacgtgtgatttcagatatttcatg
catctatatctgcattccttatttgaagcaaatccacatgctgggaaggatttccatgat
attcaggtggagctttatgctgactatgatcgaaagatgctacttccttttcttcgtagt
agtcaacattatacacttgagaaggcatatgaaatttgcattaagaaaaatcttttgagg
gagcaagtctttattcttggaagaatgggaaacgcaaaacaagtacttgctgtcatcatt
gataaattaggggatatcgaagaggcagtagagtttgttagcatgcagcatgatgatgag
ctttgggaagaattaataaagctatgtcttcacaaggctgaaatggtcggcatgttgttg
gagcacacagttggcaatctagatcctctttatattgtcaacagggttcccaatggttta
gagatacctcgccttagggatcggctcgttaaaatcattactgattacaggaccgaaacg
agtcttagacatggatgcaacgatattttgaaggctgatactgtgaatctattggttaag
tactacaaggaggccaaacatggaatttacttgagcaacgaagaagatgaagcacgcggg
aaaaggaatgaaaataaggtttctcagacgattcagaaatcatcgagtgttagaatgatg
gaggttaagtcgaaaactcggggaggcactcgatgctgcatatgtttcgatcccttttct
atacaaaacatatcggtcattgtgttcttttgctgtcatgcgtatcatgcgacttgtctc
acagaatctacctccaatcttgatgctaagaaaggggctggagagactaggcatgattcg
acatcggacttcgattatgataacggagaagtagaggatgacgatgaggatgacgatgag
aatgatacggatgtgggcggtcctagaatgcgttgtatcttatgtactactgctgcttcc
tag

DBGET integrated database retrieval system