KEGG   Momordica charantia (bitter melon): 111021555Help
Entry
111021555         CDS       T05045                                 

Definition
(RefSeq) insulin-degrading enzyme-like 1, peroxisomal isoform X1
  KO
K01408  insulysin [EC:3.4.24.56]
Organism
mcha  Momordica charantia (bitter melon)
Brite
KEGG Orthology (KO) [BR:mcha00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mcha01002]
    111021555
Enzymes [BR:mcha01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.56  insulysin
     111021555
Peptidases and inhibitors [BR:mcha01002]
 Metallo peptidases
  Family M16: pitrilysin family
   111021555
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M16_M Peptidase_M16 Peptidase_M16_C
Motif
Other DBs
NCBI-GeneID: 111021555
NCBI-ProteinID: XP_022154260
Position
Unknown
AA seq 969 aa AA seqDB search
MAVVKEQVTHEIVKPRTDKREYRRIVLRNSLEVLLVSDPDTDKSAASMTVNVGSFSDPKG
LEGLAHFLEHMLFYASEKYPLEDSYSKYITEHGGSMNAFTASEQTNYYFEVNADCFEEAL
DRFAQFFIKPLMSPDATMREIKAVDSENQKNLLSDGWRMHQLQRHISSESHPYHKFSTGN
WDTLEVQPKAKGLDTRHELIRFHEKNYSSNIMHLVVYAKENLDKVQSLVENIFQDIPNHN
CNCAHFPGQPCTSEHLKVLVRAIPIKQGHKLRIVWPITPEIHHYKEGPCRYLGHLIGHEG
EGSLYYVLKTLGWATGLSAGESDSTTNFSFFKVIIDLTDAGQEHMQDIVGLLFKYIDLLK
QSGICKWIFDELSAICETKFHYQDKIRPIDYVVNLSLNMQLYPPEDWLVGSSLPSKFNPN
LIGTVLDQLSVENFRIFWESKKFEGQTDKVEPWYGTTYSIENISGTLIQEWMLSAPDVKL
HLPAPNIFIPTDLSLKDAHEKVEFPVLLRKSSYSTLWYKPDTMFFTPKAYVKIDFRCPHA
GISPEAEVLTDIFTRLLMDYLNEYAYSAQVAGLYYGINPTEAGFQVTLIGYNHKLRVLLE
TVVEKIARFNVKPDRFLVIKETVMKEYQNFKFQQPYQQAMYYCSLILQDHTWPLMEELAI
LPHLGAEDLVKFAPTLLSSACLECYIAGNIERNESESMIEHIEDIFFKGPNPISRPLYPS
QHPTNRVVKLARGIGYFYSAEGLNPNDENSALVHYIQVHRDDFLQNVKLQLFALVAKQSA
FHQLRTVEQLGYITFLMQRNDSGIRGLQFIIQSTAKGPRNIDLRVEAFLEMFESKLVDMT
IDEFKSNVNALIDMKLEKFKNLREESGFYWREISDGTLKFDRRESEVATLRTLAHQELIN
FFNEHIKVGAPHKKALSVRVYGNLHSSEYSSDLSQPLQPDTVKIDDIFSFRRSQPLYGSF
KGAFGHVKL
NT seq 2910 nt NT seq  +upstreamnt  +downstreamnt
atggcggttgtgaaggaacaggtgactcatgagatagtgaaaccccgtacagacaaaaga
gagtaccggagaatcgtcctcaggaactctcttgaggtcctgctcgtcagtgaccctgat
accgataagagtgctgcttccatgaccgtgaacgttgggtccttcagcgaccccaaaggc
ttagagggtttagcccattttcttgagcatatgctgttttatgcaagtgaaaagtatcca
ttagaggatagttattcgaaatatatcacagagcatggaggtagcatgaatgcctttacg
gcatctgagcagacaaattattattttgaggtcaatgctgattgttttgaggaggccttg
gatagatttgctcaatttttcatcaagcctttgatgtctcccgatgctacaatgagagaa
atcaaagctgttgattctgagaatcaaaagaatttgttatctgatggttggagaatgcac
cagcttcagagacatataagttctgaaagtcatccataccataaattcagcacagggaat
tgggacactttggaggttcaaccaaaagctaaagggcttgatacaagacatgaacttata
agattccatgaaaaaaattattcatccaatatcatgcatctggttgtatatgcaaaggaa
aacctagataaagtacaaagccttgtggaaaacatatttcaagatattccaaaccataac
tgcaattgtgctcattttcctggtcagccatgcacgtcagaacatctcaaggttcttgtt
agagccatcccaattaaacaaggtcataaattgagaattgtttggccaataactcctgag
attcatcattataaggaaggaccatgccgatatctaggtcatcttattggccatgaagga
gaaggatccttgtattatgttctgaaaacattggggtgggcaacagggctctctgctggt
gaatctgattctaccacgaacttttcctttttcaaagtaataattgatcttactgatgct
ggtcaagagcacatgcaggatattgttgggctactctttaaatacattgaccttttgaag
caatctggtatatgcaaatggatatttgatgagctttcagctatttgtgagacgaagttc
cattatcaagacaaaattcgtccaattgactatgtagtcaatctttcattaaatatgcag
ttgtatcctccggaagattggttagttggttcgtctttgccttcaaaattcaatccaaac
ttaataggaacagttctggatcagctttctgtagaaaatttccgcatcttttgggagtca
aagaaattcgaaggccagactgataaggttgagccgtggtatggaactacttactccatt
gagaatatttctggcactttgattcaggaatggatgctatctgctcctgacgtaaaattg
catctaccagctcctaatattttcatccctaccgatttatcacttaaggatgcacatgaa
aaggttgagtttccagttctgctaagaaaatcatcatattcaacattatggtacaaacct
gacacaatgttcttcacgcccaaggcatatgttaagattgattttagatgtcctcatgct
ggcatctcacctgaagcagaagtcctaacggatattttcacgaggttattgatggattat
ttgaatgaatacgcttatagtgctcaggttgctggactatattatggcataaaccctaca
gaggctggtttccaggtgactctgatcggttataaccacaaattaagggttctactggaa
actgtagttgaaaaaattgcaagattcaatgtgaaacctgatagatttctcgtcatcaag
gaaactgtgatgaaggagtaccaaaatttcaagtttcaacagccatatcagcaggctatg
tactattgttcattaatacttcaagatcacacatggccattgatggaggaacttgcaatc
cttccacatttgggggctgaagatctagttaaatttgctccaactttgctctcaagtgct
tgcttggaatgttacattgcaggaaacattgaaaggaatgaatctgaatcaatgatcgaa
cacattgaagatatatttttcaaggggccaaatccaatatcacgaccattatatccatcg
cagcatccaacaaatagagttgtgaagcttgcgaggggcattggttatttctattccgca
gagggtcttaacccaaatgatgaaaattcggctcttgtccactatatccaggtgcatcga
gatgactttctacagaatgtgaagcttcagctttttgctcttgtggcaaaacaatcagct
tttcatcagcttagaactgttgaacaacttggctatattacttttctaatgcaaaggaat
gactctggtatccgyggacttcaatttattatccaatccactgcgaagggtcctcgaaat
attgatttgagagttgaagccttcctagagatgtttgagagtaagctagttgacatgacc
attgatgaattcaagagcaatgtaaatgctctaatagatatgaagcttgagaaattcaag
aacttgagggaagaatctggattttattggcgggagatttctgatgggacgttgaaattc
gataggagagaatcagaggttgcaacattaaggacactcgcacatcaggaattgatcaac
tttttcaatgaacacataaaagttggtgcacctcataagaaggctctaagtgttcgggtt
tacggaaatcttcattcttcagagtattcttcggatttaagtcaaccacttcaacctgac
acagtaaaaatagatgatattttcagtttcagaagatcacagccactttatggttccttc
aaaggagcatttggtcatgtgaagttgtag

DBGET integrated database retrieval system