KEGG   Momordica charantia (bitter melon): 111023337Help
Entry
111023337         CDS       T05045                                 

Definition
(RefSeq) acid beta-fructofuranosidase-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
mcha  Momordica charantia (bitter melon)
Pathway
mcha00052  Galactose metabolism
mcha00500  Starch and sucrose metabolism
mcha01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    111023337
   00500 Starch and sucrose metabolism
    111023337
Enzymes [BR:mcha01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     111023337
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF3357 tRNA_edit
Motif
Other DBs
NCBI-GeneID: 111023337
NCBI-ProteinID: XP_022156446
Position
Unknown
AA seq 686 aa AA seqDB search
MVNLNPFSAFFGSGDPPGSLPVYSPLPDEPAQTVDSPVIRRRPIKEAVLIASGLLLVGLL
IAVIGQNGVVFYAKLEGSSSSEPPEMVCPASRGVSAGVSEKANRQFVGQNISPFPWNHSM
LMWQRTAFHFQPEENWMNDPNGPLYHKGWYHFFYQYNPYDAVWGDISWGHAVSRDMIHWL
HLPLAIVADQWFDISGVWTGSATILPDGRIMMLYTGSTQESVQVQNLAYPANLSDPLLVD
WIKYPGNPVILPPPGIDFRDFRDPTTAWLTSEGKWRFAIGSKINQTGISLMYETEDFENF
QLLDNLLCAVPGTGMWECVDFFPVSKTEEIGLDTSVNGPAVKHVVKTSLDDDRHDYYSLG
TYDEKTGTWVPDDPTIDVGIGLRYDYGILYASKSFYDQHKRRRLLWGWIGESDSEVSDVQ
KGWASVQSIPRTILFDKKTGTNLLQWPVEEVENLRQRNDTFNNLLVQAGSVVPLDVGKAT
QLDILAEFELDEEAVAKVVXSDIEFSCQTRGGAAKRGALGPFGLLVLADESLTEHTPIYF
YVGKGQNGTLKTCFCADESRSSVANDVFKPIYGSSVPVLEDEKLSLRILVDHSVVESFAQ
GGRSCITSRVYPTKAIYNDARLFVFNNAKDTNVTASITVWQMNSAFIRPYSPGEDSKKSQ
SSVVLVPFYLFLLVSLLHLITWDVQG
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atggtgaatttgaatcccttttctgctttctttggttccggtgacccaccgggaagtctc
cccgtttacagtcccctccctgatgaacctgcccaaaccgtcgattcgccggtgattcgc
cggcgacccattaaggaggccgtcttgatcgcatctgggttgctcttggttgggttatta
atcgccgttattggtcagaatggtgtcgttttttatgcgaaattggaaggatcgtcgagc
tcggagccgccggagatggtgtgtccggcgtcacgtggggtgtcggccggcgtgtcggaa
aaggccaaccggcaatttgtgggccagaatatttctccgtttccttggaaccatagcatg
ttgatgtggcagagaacggcattccatttccagccagaggagaattggatgaatgatcct
aacggtccattatatcacaaggggtggtaccatttcttctaccagtacaatccatatgat
gcagtgtggggagacatttcttggggccatgcagtgtcgagagatatgattcattggctt
catcttcctttggccattgttgcagatcaatggtttgacattagtggtgtttggactggt
tctgccaccattctacctgatggccgaatcatgatgctctacactggctccacacaagag
tctgtccaagttcaaaacctggcatatccagccaacttatctgatcctttgctcgtcgat
tggatcaaatacccaggcaatccagttattctgccccctcctggcattgatttcagggac
ttccgtgaccctacgaccgcgtggctcacctccgaagggaaatggcggtttgctattggg
tcaaagatcaatcaaaccgggatctctttgatgtatgaaacagaggactttgaaaatttt
cagttgttggacaatctgctttgtgctgttcctggcactggaatgtgggaatgtgtggac
ttctttcctgtttcgaaaacagaggagattggcttggatacttcggttaatggacctgcc
gtgaagcatgtcgtcaagacgagcctcgacgatgatcgacacgattactattcgcttgga
acctatgatgagaagactggtacttgggttcctgatgatcccacaattgatgttgggatt
ggcttgagatacgactacggtatattgtacgcgtcaaagagtttctacgaccaacataaa
agaaggagacttttgtggggttggatcggagagtctgatagcgaagtttctgatgtgcaa
aagggatgggcatcagtacagagtattccaagaactattttgtttgataagaaaacgggc
accaatttacttcaatggccagtggaggaggttgaaaatttgagacagagaaacgatacc
ttcaataatttgttggtgcaggcaggatcagtggtgccccttgatgttggtaaagcaact
cagctagacatattggccgagttcgagttggatgaggaggcagtggcaaaggtagtcgra
agcgatatcgaattcagctgccaaacaagaggtggagcagccaagcgtggcgcattgggg
ccgtttggtcttttggtacttgcagatgagagcctcaccgagcatactcccatctacttc
tatgttggaaaaggccaaaatggtactctcaagacttgcttctgcgctgatgaatcaaga
tcatcggtggcaaacgacgttttcaagccgatctatggaagttctgttccagtactagag
gatgaaaagttgtctttaagaatcctggttgatcattcagttgtggaaagttttgctcaa
ggagggagaagttgcatcacatcaagagtttatccgacgaaagcgatctacaatgacgct
cgactattcgtattcaacaatgctaaggataccaacgtcactgcctccatcacagtatgg
cagatgaactctgcatttatacgtccatacagccccggcgaagactcaaaaaagtctcaa
tcttctgttgttttggtgcctttctacttgtttctgttagtttcactgttgcatctgatt
acatgggatgtgcaagggtga

DBGET integrated database retrieval system