KEGG   Momordica charantia (bitter melon): 111023371Help
Entry
111023371         CDS       T05045                                 

Definition
(RefSeq) probable serine/threonine-protein kinase WNK11
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
mcha  Momordica charantia (bitter melon)
Brite
KEGG Orthology (KO) [BR:mcha00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcha01001]
    111023371
   01009 Protein phosphatases and associated proteins [BR:mcha01009]
    111023371
Enzymes [BR:mcha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111023371
Protein kinases [BR:mcha01001]
 Serine/threonine kinases: Other
  Wnk family
   111023371
Protein phosphatases and associated proteins [BR:mcha01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     111023371
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal APH
Motif
Other DBs
NCBI-GeneID: 111023371
NCBI-ProteinID: XP_022156487
Position
Unknown
AA seq 303 aa AA seqDB search
MMPSATTDSSEKDAEPFVEVNPTGRYGRYGELLGTGAVKKVYRAFDQEEGIEVAWNQVKL
RSFSNEPSMIERLYSEVTLLRTLKNKNIIALYDVWLDKLHGTLNFITEVCTSGNLREYRK
KHRQVSLKALKKWSKQILQGLDYLHTHEPCVIHRDLNCSNLFVNGNVGQVKIGDLGLAAT
VGKNHSAHSVLGTPEFMAPELYEEHYTELVDIYSFGMCLLELVTLEIPYSECDNVAKIYR
KVSSGIKPQALHKVKDPEIKAFIDKCLAHSQARPSAADLLRDPIFREIDDDENDNDQDHC
ASS
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgatgcctagtgcaacgacggactcgtcggagaaggatgcggagccgttcgtggaggtg
aacccgacagggcggtacgggcggtacggggagcttctggggacgggggcagtgaagaaa
gtgtacagagcattcgatcaagaagagggaattgaggtggcgtggaaccaagtgaagctg
aggagcttttcgaacgaaccatcgatgatagagaggctgtactcggaggtgacattgctg
agaaccctaaagaacaagaacataattgctttgtacgatgtatggctcgacaaacttcat
ggaaccttaaatttcattactgaggtttgtacaagtgggaacctcagagagtacaggaag
aaacacaggcaagtttctttgaaggccttgaagaagtggtccaagcagatccttcagggt
ttggattatttgcatacccatgagccttgtgttattcatagagatctcaactgcagcaat
ctctttgtcaatggtaatgttggccaggtgaagattggggacttgggtttggcagcaaca
gtggggaagaatcactcagcacattcagtgcttgggacaccagaattcatggcaccagag
ctatatgaggaacattacacagagcttgtggacatatactcatttggaatgtgtttgctt
gaattggtcactttggaaattccctatagtgaatgtgacaatgttgccaagatctatagg
aaagtatcctccgggattaagcctcaggcccttcacaaggtcaaggaccctgagatcaag
gctttcattgacaagtgcctcgcccactcccaagcgcggccctccgcggccgacctcctc
cgagatcccattttcagggaaattgatgatgatgaaaacgacaacgaccaggatcattgt
gcatcctcgtga

DBGET integrated database retrieval system