KEGG   Momordica charantia (bitter melon): 111025066Help
Entry
111025066         CDS       T05045                                 

Definition
(RefSeq) beta-fructofuranosidase, soluble isoenzyme I-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
mcha  Momordica charantia (bitter melon)
Pathway
mcha00052  Galactose metabolism
mcha00500  Starch and sucrose metabolism
mcha01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    111025066
   00500 Starch and sucrose metabolism
    111025066
Enzymes [BR:mcha01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     111025066
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF3357
Motif
Other DBs
NCBI-GeneID: 111025066
NCBI-ProteinID: XP_022158614
Position
Unknown
AA seq 495 aa AA seqDB search
MAKTSDLEQPPYTALPDHPSPPPPRRRLFNFFAILSLLLLVSLVALINNRTPPAPAPPFR
LARGVAEGVSAKSNPYFSGGAFNWTNDMFSWQRTAFHFQPEGNWMNDPNGMYLSKCVFHF
FFLFLLVNSDFSAYSSNFHCDYFGCTGMWECVDFYPISVNGSKGLDTSVSGTGVKHVLKA
SLDDTKEDHYAIGTYFGDNDTWVPANPEEDVGIGLKLDYGRYYASKTFYDQNKERRILWG
WINETDTEENDLEKGWASVQTVPRTVVFDQKTGSNIIQWPVEEVESLRLGSTDFNSVVVG
PGSVVELKVGTATQLDIYAEFEVEALGSEDATGSGDGCGGGAAERSSLGPFGVLVLADES
LSELTPIYFNVANSTRHAYFCADEKRSSKAPDVFKQVYGSRIPVLEGENFSMRVLVDHSI
VESFGQGGRRVITSRIYPTEAIYGAAKLFIFNNATAATVKATVKVWQLNSAFIHPFLNQH
NQYMGHLNSVASFAN
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaaacttcagatctcgagcagccgccgtacacggccttgccggaccaccccagc
cccccgccgccgcgccgaaggctcttcaacttcttcgccattctctctctccttctcctc
gtctctctggttgcactgatcaacaatcggacccctccggcgcctgcgccgccgtttcgc
cttgccagaggcgtcgcggaaggcgtctccgccaaatcgaacccttacttttccggtgga
gccttcaactggaccaacgacatgttctcttggcaacgaactgccttccactttcaacca
gagggaaattggatgaacgatcccaatggtatgtacctttccaaatgcgttttccatttt
tttttcctttttcttttggttaattcggatttttctgcatattcttccaattttcattgc
gattattttgggtgtacggggatgtgggaatgcgtcgatttctacccgatatcggtcaac
gggtcgaagggtttggatacgtcggtgagcgggacgggtgtgaagcatgtactgaaggcg
agtttggatgacacaaaagaggatcattatgcaattgggacatattttggggacaatgat
acatgggtacccgccaacccggaagaggacgtgggaatcgggttgaagttggattatgga
aggtattatgcttccaagacattttatgaccaaaacaaggagaggagaattctgtggggt
tggattaacgaaactgataccgaagaaaatgacttggaaaaaggctgggcttctgtacag
actgttccaaggacagttgtattcgaccagaagacagggagcaacataatccagtggccg
gtggaagaggtggagagcttgagattgggcagcacggatttcaatagcgtagtcgtcggg
cctggctccgtcgtggaactcaaagtcggcaccgctacacaattggacatctacgcggag
ttcgaagtggaggcgcttgggtcggaggatgccaccgggtccggtgatggctgcggcggc
ggtgcggcggagaggagtagtttgggaccgttcggggtgttggttctagctgatgaatcg
ctttctgagctcactcccatttatttcaatgttgccaattccactcgccacgcttacttc
tgcgcggatgaaaaaaggtcatcaaaagctccagatgttttcaaacaagtttatgggagc
agaattcctgttttagagggtgaaaatttctccatgcgagtattggtggatcactcaatt
gtggagagttttggacaaggagggagaagagtgataacatcacgaatatacccaacagaa
gcaatatatggggcagcgaagctcttcattttcaacaacgccacagcagcaactgtgaag
gccactgtgaaggtatggcagctcaattctgccttcatccacccttttctgaaccaacac
aaccagtacatggggcacctcaattctgtcgcaagctttgcaaattaa

DBGET integrated database retrieval system