KEGG   Mycobacteroides chelonae: BB28_00015Help
Entry
BB28_00015        CDS       T04665                                 

Definition
(GenBank) 6-phosphogluconate dehydrogenase
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
mche  Mycobacteroides chelonae
Pathway
mche00030  Pentose phosphate pathway
mche00480  Glutathione metabolism
mche01100  Metabolic pathways
mche01110  Biosynthesis of secondary metabolites
mche01120  Microbial metabolism in diverse environments
mche01130  Biosynthesis of antibiotics
mche01200  Carbon metabolism
Module
mche_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
mche_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:mche00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BB28_00015
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BB28_00015
Enzymes [BR:mche01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     BB28_00015
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     BB28_00015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_2 6PGD 2-Hacid_dh_C F420_oxidored NAD_binding_11 Staph_opine_DH
Motif
Other DBs
NCBI-ProteinID: ANA96277
Position
3463..4356
Genome map
AA seq 297 aa AA seqDB search
MQLGLVGLGKMGFNMRDRLRAGGHEVIGYDPRPEVTDVPSLKGLADALETPRVVWVMVPS
GPITQQTIAELAEELSEGDLVIDGGNSRFTEDQPNADLLAAKGIGYIDAGVSGGVWGKEN
GYGLMVGGSDADVARALPIFDTLRPEGDREDGFVHAGPVGAGHYAKMIHNGIEYGLMHAY
AEGYELLAAEPLITDVQAVLQAWTKGTVVRSWLLDLLAKALKEDPGFDAISGYTEDSGEG
RWTVEEAINHRVPAPVIAASLFARFASRQEDSPAMKAVSALRNQFGGHAVKRVGLSG
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgcagctgggtttggttggactgggcaagatgggtttcaacatgcgcgaccggctgcgc
gccggtgggcatgaggtcatcggatacgacccgcgcccggaggtcaccgatgtgccgtcg
cttaaagggctggccgatgccttagagactcctcgtgtggtgtgggtgatggtgccatcg
gggccgattacccaacagacgatcgcagagcttgccgaggaattgtccgaaggcgacctc
gtgatcgacggcggtaactcaaggttcaccgaagatcagccgaacgcagatctgttggcc
gccaaggggatcggatacatcgacgcgggtgtatccggcggggtgtggggcaaggagaac
ggttacggactgatggtcggcggcagtgacgccgatgtggcgcgggcgttgcccatcttt
gacacgctgcggcctgagggtgatcgcgaggacggcttcgtacatgccggcccggtgggc
gcggggcactacgccaagatgattcacaacggtatcgagtatggcctcatgcatgcctat
gccgaagggtacgagctgctggcggccgaaccgctgatcaccgatgtgcaggccgtgctg
caggcctggaccaagggcaccgtggtgcggtcatggctgctggatctactggccaaggct
ttgaaggaagatcctggcttcgacgcgatttccggatacaccgaagactccggagaggga
cgctggaccgtagaagaggctattaatcatcgggtgcccgcgccggtcatcgctgcgtcg
ttgttcgcgagatttgcttcgcggcaggaagattcacccgcaatgaaggccgtctcggcc
ttgcgtaaccagttcggcggccacgcggtcaagcgcgtcggtctctccggctaa

DBGET integrated database retrieval system