KEGG   Mycobacteroides chelonae: BB28_03880Help
Entry
BB28_03880        CDS       T04665                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mche  Mycobacteroides chelonae
Pathway
mche00071  Fatty acid degradation
mche00072  Synthesis and degradation of ketone bodies
mche00280  Valine, leucine and isoleucine degradation
mche00310  Lysine degradation
mche00362  Benzoate degradation
mche00380  Tryptophan metabolism
mche00620  Pyruvate metabolism
mche00630  Glyoxylate and dicarboxylate metabolism
mche00640  Propanoate metabolism
mche00650  Butanoate metabolism
mche00900  Terpenoid backbone biosynthesis
mche01100  Metabolic pathways
mche01110  Biosynthesis of secondary metabolites
mche01120  Microbial metabolism in diverse environments
mche01130  Biosynthesis of antibiotics
mche01200  Carbon metabolism
mche01212  Fatty acid metabolism
mche02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mche00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BB28_03880
   00630 Glyoxylate and dicarboxylate metabolism
    BB28_03880
   00640 Propanoate metabolism
    BB28_03880
   00650 Butanoate metabolism
    BB28_03880
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BB28_03880
   00072 Synthesis and degradation of ketone bodies
    BB28_03880
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BB28_03880
   00310 Lysine degradation
    BB28_03880
   00380 Tryptophan metabolism
    BB28_03880
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BB28_03880
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BB28_03880
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BB28_03880
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mche04147]
    BB28_03880
Enzymes [BR:mche01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BB28_03880
Exosome [BR:mche04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BB28_03880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Peptidase_M22 GYD
Motif
Other DBs
NCBI-ProteinID: ANA96985
Position
complement(751429..752583)
Genome map
AA seq 384 aa AA seqDB search
MSARVAVVGVGQSKQAKKREVSIAALVREAVDGALADAELTFGDIDAIVLAKTPDLFDGV
MNPELYLADAMGARGLPVTRVFTGGSVGGHAAIYAAHLVQAGLAGRVLVVAYSKESEGNF
TWALSRPLPFSAQLGAGAGGHFAPVIREYIRRSGAPEHIGWQVAVNHRLNAIRNPYAHIH
KPDITVEEVRSSPMLWDPIRFLESCPSSDGSCAVVISSELFATHASRPPAWIHGTGWRTE
TGHFAGRDEVNPRAGQECAAAAYREARITDPATEADVSELYVPYSWYEPMWMENIGLAPE
GSGWRAVDEGHTAFEGRHPINPSGGVLSGNPTGATGLLRFAEAALQVRGLAGEHQVDGAR
RAIGHAMGGASQFHALWVVGCDKP
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcccgcgtcgccgtagtcggtgtcggacaaagcaagcaggccaagaagcgtgag
gtcagcatcgcggccctagtgcgcgaggcggtggacggtgcgctggccgacgcagagctg
acgttcggtgatatcgacgcgattgtgctcgccaagacccccgatctcttcgacggcgtg
atgaaccccgagctatacctcgccgacgcgatgggcgcgcgcggactgccggtcacccgg
gtgttcaccggtggcagcgtcggagggcatgcggccatctatgccgcacatctggtgcag
gcgggacttgccggaagggtgttggttgtcgcgtattccaaagagtcagaaggcaacttc
acctgggcactgtcccggccgctaccgttcagcgcccagctgggtgctggcgcgggtggg
catttcgcacccgttatccgcgaatacatccgccgctcgggcgcgccggaacacatcggc
tggcaagtcgcggttaatcatcgcctcaacgccatccgtaacccctacgcacatatccac
aaacccgatatcaccgtcgaggaggtacgcagctcgccgatgctctgggatcccatccgg
ttcctggaatcctgcccgtcatccgacggctcgtgtgcggtcgtcatttcttccgaactg
ttcgcgacgcatgcatcgcgaccgcccgcctggattcacggcaccggatggcgcaccgag
acaggacatttcgcgggccgcgatgaggtgaatccacgcgccgggcaggagtgcgccgcc
gcggcgtaccgcgaggcgaggatcaccgacccggccaccgaggccgacgtatccgagctc
tacgtcccctacagctggtatgagccgatgtggatggagaacatcggactggctcccgag
ggatcgggctggcgcgccgtcgacgagggccacaccgcgttcgagggcagacatccgatc
aatccgtccggtggtgtgctctcgggcaaccccaccggcgcgaccggcctgcttcggttc
gccgaggccgcgttgcaggtgcgcgggctggcgggagaacatcaagtcgacggtgccaga
cgcgcgataggccatgccatgggcggcgcatcgcagttccatgctttgtgggtggtgggg
tgcgacaaaccatga

DBGET integrated database retrieval system