KEGG   Mycobacteroides chelonae: BB28_08750Help
Entry
BB28_08750        CDS       T04665                                 

Definition
(GenBank) nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
mche  Mycobacteroides chelonae
Pathway
mche00230  Purine metabolism
mche00240  Pyrimidine metabolism
mche01100  Metabolic pathways
mche01110  Biosynthesis of secondary metabolites
mche01130  Biosynthesis of antibiotics
Module
mche_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
mche_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
mche_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:mche00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BB28_08750
   00240 Pyrimidine metabolism
    BB28_08750
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mche04131]
    BB28_08750
Enzymes [BR:mche01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     BB28_08750
Membrane trafficking [BR:mche04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    BB28_08750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: ANA97797
Position
1728291..1728701
Genome map
AA seq 136 aa AA seqDB search
MTERTLVLIKPDGVRRGLVGEVLNRIERKGLTLAALELKNVEESLASAHYAEHKDKPFFG
SLLEFITSGPVVAAVLEGPRAIAAFRQLAGGTDPVEKAATGSIRGDFALETQENLVHGSD
SPESAAREIALWFPAL
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
gtgactgagcggacgctggttttgatcaagcccgatggtgtgcggcggggacttgtcggt
gaggtgctgaaccgtattgagcgcaagggcctgacgctggctgccctcgagctcaagaac
gtcgaggagtcgctggcaagcgcgcactatgccgagcacaaggacaagccgttcttcggc
tcgctgctggaattcatcacctcggggcccgtggtggcagcagtgctggaggggccgcgc
gccatcgccgccttccgtcagctcgctggtggcaccgatcccgtggagaaggccgcgacc
ggcagcatccgcggcgacttcgccctggagacccaggagaacctggtgcacggatccgac
tcacccgagtcggcggcgcgtgagatcgcgctctggttcccggccctctga

DBGET integrated database retrieval system