KEGG   Mycobacteroides chelonae: BB28_18350Help
Entry
BB28_18350        CDS       T04665                                 

Definition
(GenBank) acyl-CoA oxidase
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
mche  Mycobacteroides chelonae
Pathway
mche00071  Fatty acid degradation
mche00410  beta-Alanine metabolism
mche00592  alpha-Linolenic acid metabolism
mche00640  Propanoate metabolism
mche01040  Biosynthesis of unsaturated fatty acids
mche01100  Metabolic pathways
mche01110  Biosynthesis of secondary metabolites
mche01212  Fatty acid metabolism
Module
mche_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mche00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BB28_18350
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BB28_18350
   00592 alpha-Linolenic acid metabolism
    BB28_18350
   01040 Biosynthesis of unsaturated fatty acids
    BB28_18350
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BB28_18350
Enzymes [BR:mche01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     BB28_18350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_2 Nup96
Motif
Other DBs
NCBI-ProteinID: ANA99564
Position
3670785..3672734
Genome map
AA seq 649 aa AA seqDB search
METRTAPADPEVLTSNLRVALDGRFGPIRDAAREYLNRADLLPDPSLTLEEARTRSLRIL
RELVPHGLPHAGFRKEHGGTGDVGAAIVGIEMLGYADLSLMVKAGVQWGLFGGAIENLGT
ATHHKQYVVPLINLDVLGCFGMTETGHGSNVQALQTVATYDNQTGDFVLNSEGSLARKDY
IGGAAEHATVAAVFAQLVTGGPGEEASGRGVHCFVVPIRDAAGNDLPGITTSDCGYKGGL
AGVDNGRIVFDNVRVPRANLLNKYADVNADGSYTSPIENENKRFFTMLGTLIRGRVSVAA
TSGAAARKALTIASRYALVRKQFDTPDSDDEVIIADYLVHQRKLLPLIARSYALAFAQNE
LTEELHEVQTADEVDADRQRQLESAAAGLKAMTSWHAQNTITVCREACGGAGYLDANQLT
ILRRDIDVFTTFEGDNTVLTQLVAKELLSAYAEDVRGLNAVGWTRFIAGMARDVILERSA
ARQVIQTILDSSDEDVEESDLSNRGTQLRLLRNREDHLLRTAATRMQRAQSDDEDPFEVF
NSAQDHILKVGSAHTERVVLEAFIEAIDSCDSKSAQELLEKLCDLFVYSTLEADLSWFLM
HRHVSTERAKAIRRGVNQLCEELRPHLSTLVDAFGIPEALLATEMIPDN
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atggagacccggacagcacctgccgatcccgaagtcctcacctcgaatctgcgcgttgcg
ctcgacggccgattcggcccgatacgtgatgccgcccgcgagtacctgaaccgcgccgat
ctgctacctgatccctcactgacactcgaggaggctcggacgcgttcactgcgcatcttg
cgcgagctggttccacatggcttgccgcacgcgggattccgcaaggaacacggaggtacc
ggcgatgtcggagccgcgatcgtcggcatcgagatgctcggctacgcggatctgtcactc
atggtcaaggccggcgtgcaatggggcttgttcggcggtgccatcgaaaacctcggcacc
gcaactcatcacaagcagtacgtagtaccgctgatcaatctggacgtactcggatgtttc
ggcatgaccgagaccggccatggttccaacgttcaggccctgcagaccgtcgccacctac
gacaaccagaccggcgacttcgttctgaactcggagggctcgctggcacgtaaggactac
attggtggcgccgcggagcacgccaccgtggccgcggttttcgctcagctcgtcaccggc
gggcctggcgaagaggcatccggccggggagtgcattgcttcgtggtacccatccgggac
gcggcgggcaatgatctgcccggcatcaccaccagcgactgcggatacaaaggcggcctc
gccggagtcgacaacgggcgcattgtgttcgacaacgtgcgggtgcctcgcgccaacctg
ctcaacaaatatgcggacgtcaacgccgacggctcctacacctcgcccatcgagaatgag
aacaagcgattcttcaccatgctgggcacactcatccgcggacgggtcagcgtcgccgcg
acctccggtgcggcggcccgcaaggcgctgaccatcgcatcgcggtatgccctggtacgc
aagcagtttgacacgccggacagcgacgacgaggtgatcatcgccgactatctggtgcat
cagcgcaagctactgcccctgatcgcccggtcgtacgcactggcattcgcgcagaacgag
ctcaccgaggaactgcacgaggtgcagaccgccgacgaggtggacgcggaccggcagcgc
cagctggaaagtgccgcagcgggtttgaaggcgatgaccagctggcacgcccagaacacc
atcaccgtgtgccgcgaggcgtgcggtggggccggctatctcgatgccaaccagctcacc
attctgcgccgcgatatcgacgtgttcaccaccttcgaaggcgataacaccgtgctcacc
caactggtggccaaggaactcctgtcggcctacgccgaggatgtgcgtggtctcaatgct
gtgggctggacccggtttatcgcaggcatggcccgcgacgtgatcctggaacgctccgcg
gcccggcaggtaatccagaccatcctggactcttccgacgaggacgtcgaggaatccgat
ttgagcaacaggggcacccagctgcgactgctgcgcaatcgcgaagatcacctgctgcgc
accgcggccacccggatgcagcgtgcccaatctgatgatgaagaccccttcgaggtcttc
aactccgcacaggaccacatcctcaaagtgggctcggcccacaccgaacgggtggtgctg
gaagccttcatcgaagcgatcgacagctgcgacagcaagtccgcacaggaactattggag
aagctgtgcgatctgtttgtctacagcacgctcgaagcggacctgtcatggttcctgatg
caccggcatgtctcgaccgaacgcgcgaaggccatcaggcgcggtgtcaatcaactgtgc
gaggagctgcgcccgcatctgagcacactggtcgatgctttcggaattcccgaggcgctg
ctcgccacggagatgatccccgacaactag

DBGET integrated database retrieval system