KEGG   Mycobacteroides chelonae: BB28_19545Help
Entry
BB28_19545        CDS       T04665                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
mche  Mycobacteroides chelonae
Pathway
mche03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mche00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BB28_19545
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mche03011]
    BB28_19545
Ribosome [BR:mche03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BB28_19545
  Bacteria
    BB28_19545
  Archaea
    BB28_19545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ANA99787
Position
complement(3914087..3914560)
Genome map
AA seq 157 aa AA seqDB search
MTTTTEYPSAKAVARFVRVSPTKARRVIDLVRGKSVTDAIDILRWAPQAASEPVSKVIAS
AAANAQNNDGLDPSTLVVTEIFADEGPTAKRIRPRAQGRAFRIRKRTSHITVVVESRPKS
EKGGKGGTSQAAARARRAEGSKAAANKTTAEAKGGSR
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgactacaacgactgaatacccatcggccaaggccgttgcacggttcgtgcgggtctcg
ccgaccaaggcacgccgggtcatcgacctggtgcgcggcaagtcggtaaccgacgccatc
gacatcctgcggtgggcaccgcaggcagccagcgagccggtttccaaggtcatcgcgagc
gctgctgccaacgcgcagaacaacgacggactggatccctccacccttgtggtgacggag
atcttcgccgacgaaggcccgaccgctaagcgcatccgtccccgcgcgcagggtcgtgca
ttccggatccgcaagcgcaccagccacatcaccgtggtggtggagagccgtcccaagtcc
gagaagggtggtaagggcggaacctcacaggccgccgctcgcgcccgccgggccgagggc
tcgaaggctgccgccaacaagaccaccgctgaggcgaagggaggctcgcgctag

DBGET integrated database retrieval system