KEGG   Mycobacterium chimaera: AN480_02515Help
Entry
AN480_02515       CDS       T04926                                 

Definition
(GenBank) arylamine N-acetyltransferase
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
mchi  Mycobacterium chimaera
Pathway
mchi00633  Nitrotoluene degradation
mchi00983  Drug metabolism - other enzymes
mchi01100  Metabolic pathways
mchi01110  Biosynthesis of secondary metabolites
mchi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mchi00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    AN480_02515
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    AN480_02515
   00983 Drug metabolism - other enzymes
    AN480_02515
Enzymes [BR:mchi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     AN480_02515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-ProteinID: APD83877
UniProt: A0A220Y677
Position
510042..510872
Genome map
AA seq 276 aa AA seqDB search
MTLDLGAYFDRIDYCGAAEPNLEVLQDLMTAHTGSIPFENLDPLMGVPVDDLSPEALTDK
LVYRRRGGYCYEQNGLMGYVLAEIGFRVRRLAGRVVWMQPPDAPLGAQTHTALAVTFPGS
QGSYLVDVGFGGQTLTSPIRFETGNAQQTTHEPYRLNDRGDGLVLQALVRDEWKPLYVFG
TQTVPQIDLRVGSWYVSTYPESHFVTGLMAALTTADARYNLAGRHLTVHRADGSEKIRLD
DAAAVVDVLGERFGIDVAGIGERSALEARIGQVLDA
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgacgctggatctgggcgcgtacttcgatcgcatcgactactgcggcgccgccgagccg
aatctcgaggtgctgcaggatctgatgaccgcgcacaccgggtcgatcccgttcgagaac
ctcgatccgctgatgggggtgccggtcgacgacctgagccccgaagccctcaccgacaag
ctggtgtaccggcgccggggcggctactgctacgagcagaacggcctaatgggttacgtg
ctggccgagatcgggttccgggtgcgccgcctggccgggcgggtggtctggatgcagccg
cccgacgcgccgctgggagcccagacgcacacggcgctggctgtgacgttcccgggctcg
cagggctcctatctggtcgacgtcggtttcggtggtcagacgctgacgtcccccatccgc
ttcgagaccggaaacgcccagcagacaacgcacgagccgtaccggctcaacgaccgcggc
gacggcctggtgctgcaagccctggtccgcgacgagtggaaaccgctgtacgtgttcggc
acccagaccgtgccgcagatcgatctgcgggtgggcagctggtacgtctcgacgtacccc
gagtcgcacttcgtgaccgggctgatggccgccctgacgaccgccgacgcccgctacaac
ctggccggccgccatctgaccgtccaccgcgccgacggcagcgagaagatccgcctggac
gacgcggcggcggtcgtcgacgtgctcggtgagcgattcggcatcgacgtggccggcatc
ggcgagcgcagtgcgctcgaggcgcgcatcgggcaggtgctggacgcgtag

DBGET integrated database retrieval system