KEGG   Mycobacterium chimaera: AN480_02685Help
Entry
AN480_02685       CDS       T04926                                 

Definition
(GenBank) 4-hydroxy-2-oxovalerate aldolase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
mchi  Mycobacterium chimaera
Pathway
mchi00360  Phenylalanine metabolism
mchi00362  Benzoate degradation
mchi00621  Dioxin degradation
mchi00622  Xylene degradation
mchi01100  Metabolic pathways
mchi01120  Microbial metabolism in diverse environments
mchi01220  Degradation of aromatic compounds
Module
mchi_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mchi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    AN480_02685
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AN480_02685
   00622 Xylene degradation
    AN480_02685
   00621 Dioxin degradation
    AN480_02685
Enzymes [BR:mchi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     AN480_02685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm
Motif
Other DBs
NCBI-ProteinID: AOS90611
UniProt: A0A1Y0SXD7
Position
542394..543452
Genome map
AA seq 352 aa AA seqDB search
MTTDIFFNPVWDVRMTDTSLRDGSHHKRHQFTKDEVGAIVAALDAAGVPVIEVTHGDGLG
GSSFNYGFSKTPEQELIKLAAETAKEAKIAFLMLPGVGTKEDIKEAQNNGGSICRIATHC
TEADVSIQHFGLARELGLETVGFLMMSHTISPEKLAAQARIMADAGCQCVYVVDSAGALV
LEGVRDRVAALVAELGDDAQVGFHGHENLGLGVANSVEAVRAGAKQIDGSCRRFGAGAGN
APVEALIGVFDKIGVKTGIDFFDIADAAEEVVAPAMPAECLLDRNALIMGYSGVYSSFLK
HAIRQGERYGVPPHELLHRAGQRKLIGGQEDQLIDIALEIKRERESGAAAAR
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgactaccgacatcttcttcaacccggtctgggacgtgcggatgacggacacgtcgctg
cgcgacggctcgcaccacaagcgccaccagttcaccaaggacgaggtcggcgcgatcgtg
gccgccctggacgccgcgggtgtgcccgtcatcgaggtcacccacggcgacggactgggt
ggctcgagcttcaactacgggttctccaagacccccgagcaggagctgatcaagctcgcc
gccgagaccgccaaagaggccaaaatcgccttcttgatgctgcccggcgtgggcaccaag
gaagacatcaaagaggcccagaacaacggcggttcgatctgccggatcgccacgcactgc
accgaggccgacgtctcgatccagcacttcggcctggcccgcgagctcggcctggaaacc
gtcggcttcttgatgatgagccacaccatttcgccggagaagctggccgcccaggcccgc
atcatggccgacgcgggctgccagtgcgtctacgtggtcgactcggccggggcgctggtc
ctcgagggcgtgcgggaccgggtcgcggcgctggtcgccgaactcggtgacgacgcccag
gtcggcttccacgggcacgaaaacctcggactcggggtggccaatagcgtcgaggccgtg
cgcgccggcgccaagcagatcgacggctcgtgccgccgcttcggggccggggcgggcaac
gcccccgtcgaggccctgatcggggtgttcgacaagatcggcgtcaagaccggcatcgac
ttcttcgacatcgccgacgccgccgaggaggtcgtcgccccagccatgcccgccgagtgc
ctgctcgaccgcaacgccctgatcatgggctactccggggtgtactccagcttcctcaag
cacgccatccgccagggtgagcgctacggcgtcccgccgcatgagctgttgcaccgggcc
ggccagcgcaagctcatcggcggccaggaggaccaactgatcgacatcgcgctggagatc
aagcgcgagcgagaaagcggcgccgccgccgcgcgctga

DBGET integrated database retrieval system