KEGG   Mycobacterium chimaera: AN480_05160Help
Entry
AN480_05160       CDS       T04926                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mchi  Mycobacterium chimaera
Pathway
mchi00010  Glycolysis / Gluconeogenesis
mchi00053  Ascorbate and aldarate metabolism
mchi00071  Fatty acid degradation
mchi00280  Valine, leucine and isoleucine degradation
mchi00310  Lysine degradation
mchi00330  Arginine and proline metabolism
mchi00340  Histidine metabolism
mchi00380  Tryptophan metabolism
mchi00410  beta-Alanine metabolism
mchi00561  Glycerolipid metabolism
mchi00620  Pyruvate metabolism
mchi00625  Chloroalkane and chloroalkene degradation
mchi00903  Limonene and pinene degradation
mchi01100  Metabolic pathways
mchi01110  Biosynthesis of secondary metabolites
mchi01120  Microbial metabolism in diverse environments
mchi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mchi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AN480_05160
   00053 Ascorbate and aldarate metabolism
    AN480_05160
   00620 Pyruvate metabolism
    AN480_05160
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AN480_05160
   00561 Glycerolipid metabolism
    AN480_05160
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AN480_05160
   00310 Lysine degradation
    AN480_05160
   00330 Arginine and proline metabolism
    AN480_05160
   00340 Histidine metabolism
    AN480_05160
   00380 Tryptophan metabolism
    AN480_05160
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AN480_05160
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AN480_05160
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AN480_05160
Enzymes [BR:mchi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     AN480_05160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487 LuxC
Motif
Other DBs
NCBI-ProteinID: AOS90965
UniProt: A0A220Y8K9
Position
complement(1061389..1062813)
Genome map
AA seq 474 aa AA seqDB search
MTITQSFINGESVASADVYDNIDPATGRSLGPVARGGLDETDRAVNAARAASAPWRDTSP
EERAILLTRIADLIDQNHERLARIESEDTGKPLSQARGDAGVAGRYFRFYGHAIDSYYGQ
TIPLATDLHAYTRREPFGVTGHIIAWNYPMQLLARAVAPAIAVGNCAVVKPADETPRTAV
ELAVLAVQAGLPPGVFNVVTGIGAEAGAALTAHPDVDHLGFVGSTEIGSVVAHAAADRVT
PTTLELGGKSPQIVFPDADLARASESIAKAILQNAGQTCSAGSRLLVHDTIHDTLVEMVR
MRLSSTTIGPGVEDHDLGPLISRKQQQRVRSMLADNVDGEILCGGAPPDDPRLTDGAYFC
PTIIDDADPSSAIAQEEIFGPVLTVHRFRTEDEAIALANGTQYALLGAVWTTDLSRAHRL
AAQIHAGQIYVNTYGAGGGVELPFGGFKKSGYGREKGYEALDTFSATKTVVVRL
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
gtgaccatcacgcagtcattcatcaacggtgaatcggtggcatccgcggacgtgtacgac
aacatcgatccggccaccggacgatccctcggtccggtggcgcgcggcgggcttgacgaa
acagatcgcgccgtcaacgcggcccgagcggcgtcggccccttggcgagacacgtcaccc
gaggaacgcgcgatcctgttgacgcggatcgccgatctcatcgaccagaatcacgaacgg
ttggcccggatcgaaagcgaggacaccgggaagccgctgagccaggcgcgcggggatgca
ggcgttgccgggcgttacttccgtttctacggccacgccatcgactcctactacggccaa
accatcccgctcgcaacggatttacacgcgtatacccgacgcgagccattcggcgtaacc
ggtcacatcatcgcctggaactacccgatgcagttgctcgcccgtgccgtggctcccgcc
atcgcggtgggcaactgcgcggtggtcaagcccgccgacgaaacacccagaacggcagtg
gaactcgccgtgctcgcggtgcaggccgggctcccgcccggggtgttcaacgtggtgacc
gggatcggcgccgaagccggcgccgccctgacggcacaccccgacgtcgatcacctgggg
tttgtcgggtcgactgaaatcgggtccgtggtcgcccacgccgcggcggatcgggtgaca
cccacgacgctggagttgggcggcaaatccccgcagatcgtcttccccgatgcggatctg
gcccgcgcatcggagtcgatcgcgaaggcaattctgcagaacgcgggtcaaacatgctcg
gccggctcacgtctgctggtacacgacacgatccacgacaccctggtcgagatggtgcgc
atgcgtttgtcgtcgaccacgattgggcccggagtcgaggaccacgacctcggaccgctg
atctcccgaaagcagcagcagcgggtgcgatccatgctcgccgataatgtcgacggcgaa
atcctttgcggcggggcacctcctgacgatccgcgcctgactgacggtgcgtacttctgt
cccacgatcatcgacgacgccgacccctcgtcagcgatcgcgcaggaggagatcttcgga
ccggtgctgaccgtccaccggttccgcaccgaggacgaggcgatcgcattggccaacggc
acgcaatacgctctgctcggcgcggtgtggacgaccgatctgtcccgcgcgcaccggctg
gcggcgcagatccacgcgggccagatttacgtgaatacctatggcgccggcggcggagtg
gaactaccgttcggaggtttcaagaaatcgggctacggccgcgagaagggctatgaagcc
ctcgacacgttcagcgccaccaagactgtcgtggtgcggctttga

DBGET integrated database retrieval system