KEGG   Mycobacterium chimaera: AN480_06605Help
Entry
AN480_06605       CDS       T04926                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mchi  Mycobacterium chimaera
Pathway
mchi00071  Fatty acid degradation
mchi00072  Synthesis and degradation of ketone bodies
mchi00280  Valine, leucine and isoleucine degradation
mchi00310  Lysine degradation
mchi00362  Benzoate degradation
mchi00380  Tryptophan metabolism
mchi00620  Pyruvate metabolism
mchi00630  Glyoxylate and dicarboxylate metabolism
mchi00640  Propanoate metabolism
mchi00650  Butanoate metabolism
mchi00900  Terpenoid backbone biosynthesis
mchi01100  Metabolic pathways
mchi01110  Biosynthesis of secondary metabolites
mchi01120  Microbial metabolism in diverse environments
mchi01130  Biosynthesis of antibiotics
mchi01200  Carbon metabolism
mchi01212  Fatty acid metabolism
mchi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mchi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AN480_06605
   00630 Glyoxylate and dicarboxylate metabolism
    AN480_06605
   00640 Propanoate metabolism
    AN480_06605
   00650 Butanoate metabolism
    AN480_06605
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AN480_06605
   00072 Synthesis and degradation of ketone bodies
    AN480_06605
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AN480_06605
   00310 Lysine degradation
    AN480_06605
   00380 Tryptophan metabolism
    AN480_06605
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AN480_06605
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AN480_06605
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AN480_06605
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mchi04147]
    AN480_06605
Enzymes [BR:mchi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AN480_06605
Exosome [BR:mchi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AN480_06605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt TPR_19
Motif
Other DBs
NCBI-ProteinID: AOS91198
UniProt: A0A1Y0SZD3
Position
complement(1364092..1365309)
Genome map
AA seq 405 aa AA seqDB search
MPEAVIVSTARSPIGRAMKGSLVNMRPDDLTVQIVKAALDKVPALNPHQIDDLILGCGQP
AGESGYNLARVIAVELGFDFLPGTTVNRYCSSSLQTSRMAFHAIKAGEGDAFISAGVETV
SRFAKGSADSWPDTKNSLFAEAQERSAAAAEGAEEWHDPRADGNLPDVYIAMGQTAENVA
LLTGISREDQDHWGVRSQNRAEEAIKSGFFEREITPVTLPDGTTVSTDDGPRPGTTYEKI
SQLKPVFRPNGTVTAGNACPLNDGAAAVVITSDTKAKELGLTPLARIVSTGVSGLSPEIM
GLGPIEATKKALARAKLSVSDIDLFEINEAFAVQVLGSARELGIDEDKLNVSGGAIALGH
PFGMTGARIATTLLNNLQTHDKTFGLETMCVGGGQGMAMVIERLS
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaagccgtcattgtctcaactgctcgctcgccgatcggccgcgcgatgaagggg
tcgctggtcaacatgcgccccgacgacctgaccgtccagatcgtgaaggccgcgctggac
aaggtccccgccctgaacccgcaccagatcgacgacctgatcctgggctgcgggcagccc
gccggtgaatccggatacaacctggcgcgagtcatcgccgtcgagctcggcttcgacttc
ctgccgggcaccaccgtcaaccggtactgctcgtcgtcgctgcagacctcccggatggcg
ttccacgcgatcaaggccggtgagggcgacgcgttcatctcggcgggtgtggaaaccgtg
tcgcggttcgccaagggcagcgccgactcgtggccggacaccaagaactcgctgttcgcc
gaggcccaggagcgctcggccgccgcggccgaaggcgccgaggagtggcacgatccccgc
gccgacggcaacctgcccgacgtgtacatcgcgatggggcagaccgccgagaacgtcgcc
ttgctgaccggcatcagccgcgaagaccaggaccactggggagtgcgcagccagaaccgc
gccgaggaggcgatcaagagcgggttcttcgagcgggagatcaccccggtgaccctgccc
gacggcaccacggtgagcaccgacgatggcccccgccccggcaccacctacgagaagatc
agccaactcaagccggtgttccggcccaacggcacggtgaccgcgggcaacgcgtgcccg
ctgaacgacggcgcggccgcggtggtgatcaccagcgacaccaaggccaaggaactcggc
ctgacgccgctggcgcggatcgtgtccactggggtcagcggcctctccccggagatcatg
ggcctgggcccgatcgaggcgaccaagaaggcgctggcgcgggccaagctgtccgtcagc
gacatcgacctgttcgagatcaacgaggcgttcgccgtccaggtcctgggctcggcccgc
gagctgggcatcgacgaggacaagctgaacgtgtccggcggggcgatcgcgctgggccac
ccgttcggcatgaccggcgcccgcatcgccaccacgctgctcaacaacctgcagacgcac
gacaagacgttcggcctggagaccatgtgcgtcggcggcgggcagggcatggcgatggtg
atcgagcggctcagctga

DBGET integrated database retrieval system